KEGG   Bacillus subtilis subsp. subtilis 168: BSU24620
Entry
BSU24620          CDS       T00010                                 

Symbol
tasA
Name
(RefSeq) spore coat protein N
  KO
K06336  spore coat-associated protein N
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU24620 (tasA)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M73
   BSU24620 (tasA)
SSDB
Motif
Pfam: Peptidase_M73 YSIRK_signal
Other DBs
NCBI-GeneID: 938545
NCBI-ProteinID: NP_390342
Pasteur: BG11697
BSORF: BG11697
UniProt: P54507 A0A6M3ZED2
Structure
Position
complement(2553081..2553866)
AA seq 261 aa
MGMKKKLSLGVASAALGLALVGGGTWAAFNDIKSKDATFASGTLDLSAKENSASVNLSNL
KPGDKLTKDFQFENNGSLAIKEVLMALNYGDFKANGGSNTSPEDFLSQFEVTLLTVGKEG
GNGYPKNIILDDANLKDLYLMSAKNDAAAAEKIKKQIDPKFLNASGKVNVATIDGKTAPE
YDGVPKTPTDFDQVQMEIQFKDDKTKDEKGLMVQNKYQGNSIKLQFSFEATQWNGLTIKK
DHTDKDGYVKENEKAHSEDKN
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggtatgaaaaagaaattgagtttaggagttgcttctgcagcactaggattagcttta
gttggaggaggaacatgggcagcatttaacgacattaaatcaaaggatgctacttttgca
tcaggtacgcttgatttatctgctaaagagaattcagcgagtgtgaacttatcaaatcta
aagccgggagataagttgacaaaggatttccaatttgaaaataacggatcacttgcgatc
aaagaagttctaatggcgcttaattatggagattttaaagcaaacggcggcagcaataca
tctccagaagatttcctcagccagtttgaagtgacattgttgacagttggaaaagagggc
ggcaatggctacccgaaaaacattattttagatgatgcgaaccttaaagacttgtatttg
atgtctgctaaaaatgatgcagcggctgctgaaaaaatcaaaaaacaaattgaccctaaa
ttcttaaatgcaagcggtaaagtcaatgtagcaacaattgatggtaaaaccgctcctgaa
tatgatggtgttccaaaaacaccaactgacttcgatcaggttcaaatggaaatccaattc
aaggatgataaaacaaaagatgaaaaagggcttatggttcaaaataaatatcaaggcaac
tccattaagcttcaattctcattcgaagctacacagtggaacggcttgacaatcaaaaag
gaccatactgataaagatggttacgtgaaagaaaatgaaaaagcgcatagcgaggataaa
aattaa

DBGET integrated database retrieval system