KEGG   Bacillus subtilis subsp. subtilis 168: BSU24640
Entry
BSU24640          CDS       T00010                                 

Symbol
yqxM
Name
(RefSeq) hypothetical protein
  KO
K19433  TasA anchoring/assembly protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    BSU24640 (yqxM)
SSDB
Motif
Pfam: Herpes_PAP
Other DBs
NCBI-GeneID: 938532
NCBI-ProteinID: NP_390344
Pasteur: BG11076
BSORF: BG11076
UniProt: P40949 A0A6M4JJ23
Structure
Position
complement(2554486..2555247)
AA seq 253 aa
MFRLFHNQQKAKTKLKVLLIFQLSVIFSLTAAICLQFSDDTSAAFHDIETFDVSLQTCKD
FQHTDKNCHYDKRWDQSDLHISDQTDTKGTVCSPFALFAVLENTGEKLKKSKWKWELHKL
ENARKPLKDGNVIEKGFVSNQIGDSLYKIETKKKMKPGIYAFKVYKPAGYPANGSTFEWS
EPMRLAKCDEKPTVPKKETKSDVKKENETTQKDIPEKTMKEETSQEAVTKEKETQSDQKE
SGEEDEKSNEADQ
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtttcgattgtttcacaatcagcaaaaggcgaagacgaaactgaaagttctgcttatc
tttcagctttcagtcattttcagtctgactgccgcaatatgcttacaattttccgatgat
acaagcgctgcttttcatgatattgaaacatttgatgtctcacttcaaacgtgtaaagac
tttcagcatacagataaaaactgccattatgataaacgctgggatcaaagtgatttgcac
atatcagatcaaacggatacgaaaggcactgtatgctcacctttcgccttatttgctgtg
ctcgaaaatacaggtgagaaacttaagaaatcaaagtggaagtgggagcttcataagctt
gaaaatgcccgcaaaccgttaaaggatgggaacgtgatcgaaaaaggatttgtctccaat
caaatcggcgattcactttataaaattgagaccaagaaaaaaatgaaacccggcatttat
gcatttaaagtatataaaccggcaggctacccggcaaacggcagtacatttgagtggtcg
gagcctatgaggcttgcaaaatgcgatgaaaaaccgacagtccctaaaaaagaaacaaag
tcggacgtcaaaaaggagaatgaaacaacacaaaaagatataccggaaaaaacaatgaaa
gaagaaacatctcaagaagctgtaaccaaagaaaaagaaactcaatcagaccagaaggaa
agcggggaagaggatgaaaaaagcaatgaagctgatcagtaa

DBGET integrated database retrieval system