KEGG   Bacillus subtilis subsp. subtilis 168: BSU24670
Entry
BSU24670          CDS       T00010                                 

Symbol
comGG
Name
(RefSeq) ComG operon protein 7
  KO
K02249  competence protein ComGG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU24670 (comGG)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU24670 (comGG)
SSDB
Motif
Pfam: ComGG PsaX
Other DBs
NCBI-GeneID: 938538
NCBI-ProteinID: NP_390347
Pasteur: BG10489
BSORF: BG10489
UniProt: P25959 A0A6M3ZDM9
Position
complement(2556137..2556511)
AA seq 124 aa
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRH
VLEERKGQEGTQQFLYGRVSYYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLL
RWTE
NT seq 375 nt   +upstreamnt  +downstreamnt
atgtatcgtacaagagggtttatttatccagctgttctttttgtgtcagcgcttgtgctg
ttaatcgtgaactttgttgctgctcaatatatttcacgctgcatgtttgagaaggaaaca
aaagagttatacataggagagaatttgcttcaaaatggggtgcttctttcgattcggcat
gttctagaggaacggaaaggccaggagggtacgcagcaatttctatatggacgggtttct
tattacattcatgatacatcgataaaagaacaaaaagaaatcaacttaagagtgtcaacg
gattcgggaacagaaagaactgcacagatcgtgtttgaccaaaaacagaaaaaactgctg
agatggacagaataa

DBGET integrated database retrieval system