KEGG   Bacillus subtilis subsp. subtilis 168: BSU24710
Entry
BSU24710          CDS       T00010                                 

Symbol
comGC
Name
(RefSeq) ComG operon protein 3
  KO
K02245  competence protein ComGC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU24710 (comGC)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU24710 (comGC)
SSDB
Motif
Pfam: N_methyl DUF1980 SecD-TM1 TadF
Other DBs
NCBI-GeneID: 938526
NCBI-ProteinID: NP_390351
Pasteur: BG10485
BSORF: BG10485
UniProt: P25955 A0A6M4JNP0
Position
complement(2557673..2557969)
AA seq 98 aa
MNEKGFTLVEMLIVLFIISILLLITIPNVTKHNQTIQKKGCEGLQNMVKAQMTAFELDHE
GQTPSLADLQSEGYVKKDAVCPNGKRIIITGGEVKVEH
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaatgagaaaggatttacacttgttgaaatgttaatcgtgctctttattatttcgatt
ttgcttttaattacgataccgaacgtcacgaaacataatcaaaccattcaaaaaaagggc
tgtgaaggcttacaaaacatggttaaggcacaaatgactgcatttgagcttgatcatgaa
ggacaaactccgagccttgccgatttacagtcagagggctatgtgaaaaaggatgctgtc
tgtccaaatggtaagcgcattatcatcaccggcggagaagttaaggttgaacattaa

DBGET integrated database retrieval system