KEGG   Bacillus subtilis subsp. subtilis 168: BSU24740
Entry
BSU24740          CDS       T00010                                 

Symbol
yqxL
Name
(RefSeq) magnesium transport protein CorA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CorA
Other DBs
NCBI-GeneID: 938517
NCBI-ProteinID: NP_390354
Pasteur: BG11075
BSORF: BG11075
UniProt: P40948 A0A6M3ZDS3
Position
complement(2560489..2561442)
AA seq 317 aa
MKAHTGKDWFWYQMGPQERSKARDLIHFSHWPQCEKWFENNHHVNFLRVDTTETENEAVF
GSIVYDQGLGEEKDHTVFHFYITRQYFFTINFDFSILREIKGKEVVRQMERADNAIEGFL
ILLGELMNAYLIGVDEFEVKLRKLRWQIKDDNSKSILNRVHLLRHELMIWKNLILSAKKI
EMALKETFLPQNEGKKDYQRTQLKIDRGFTYISEFEGELNNLLHSEEVITSHRGNEIVKA
LTIFTTLFTPITALGALWGMNFSVMPELNWKYGYLFSLLLIVTSTVLIYLYLRKKGWTGD
MLQERKKKKKPRKRRTL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaaggcacatacgggaaaggattggttttggtaccaaatggggcctcaagaaagaagt
aaggcaagagatctaatccatttttctcactggcctcagtgtgaaaagtggtttgaaaat
aaccatcacgttaattttttgcgagtagatacaactgaaacggaaaatgaagcagtattt
gggtcgattgtttatgatcaggggcttggtgaagaaaaagaccatactgtttttcacttt
tatatcaccagacaatatttttttacaatcaactttgacttttcaattttgagagagatt
aaaggcaaagaagttgttcggcaaatggaaagagcggacaatgcgatagaggggttttta
attcttctcggcgaactaatgaatgcgtatttaatcggtgttgatgaatttgaagtcaag
ctgagaaagctcagatggcaaattaaagacgacaatagcaaaagcattttaaaccgcgtc
catctcctgcgccatgaactgatgatttggaaaaatttgatattaagcgctaaaaaaatt
gaaatggcgttgaaagaaacctttttacctcaaaatgaagggaaaaaggattatcagcgg
acacaactgaagattgacaggggatttacatacatcagcgaatttgaaggggagcttaac
aatctgctgcattcagaggaagtcattacctcacatagggggaatgaaattgtaaaagcg
ctgaccattttcacgacgctttttactccgattacagctctgggtgccttatgggggatg
aacttttcagtgatgccggaactgaattggaaatacggatatctcttttccctcttattg
attgtcacatctacagttctgatctatctctatttgagaaaaaaaggctggacgggagat
atgctgcaggagcggaagaagaaaaagaaacctcgaaaaaggcggactctatag

DBGET integrated database retrieval system