KEGG   Bacillus subtilis subsp. subtilis 168: BSU24850Help
Entry
BSU24850          CDS       T00010                                 

Gene name
glcK
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00521  Streptomycin biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU24850 (glcK)
   00052 Galactose metabolism
    BSU24850 (glcK)
   00500 Starch and sucrose metabolism
    BSU24850 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU24850 (glcK)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU24850 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BSU24850 (glcK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BSU24850 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FtsA DUF1464
Motif
Other DBs
NCBI-GeneID: 938206
NCBI-ProteinID: NP_390365
Pasteur: BG11685
BSORF: BG11685
UniProt: P54495
Position
complement(2570606..2571571)
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVTIAKTIDSKLDELQKP
KHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIANAKKTTRLKATEQLSARDVFEAAGENDEIALEVVDYVAK
HLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAQAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatatggtttgcgggcattgacctgggaggaacgacgattaaactcgctttt
attaatcaatatggcgaaattcagcataagtgggaagttccgacagataaaaccggcgac
acgattactgtcacaattgcaaaaacaatcgacagcaagctggatgagctgcaaaaaccg
aagcacatcatcaaatacatcggaatgggtgcaccaggccctgtagatatggcggcagga
gtggtttatgaaacagtaaatctagggtggaaaaattatgctttgaaaaaccatctggag
acagaaaccggcatcccagctgttatagaaaatgacgcgaatattgctgcgctcggggaa
atgtggaagggagcgggtgatggcgcaaaagacgtcattctcgtgacgcttggcacagga
gttggcggcggcatcattgcaaatggtgaaattgtacatggtataaatggcgccggcgga
gaaatcggccatatttgcagcatccctgaaggcggagcgccctgcaactgcggcaaaacg
ggctgtatcgaaacaattgcgtcagcaaccggaattgtaagaattgcaaaagaaaaaata
gcaaatgctaaaaagacgacacgtttaaaagcaaccgaacaattgtcagcgcgagatgtg
tttgaagcggcgggtgaaaatgatgaaattgcccttgaggtggttgattatgtagccaag
catcttggtttggtgctcggaaatttggcaagctcgcttaatccatccaaaatcgttctt
ggcggcggcgtatcgagagccggagaactgctgagatcaaaagtcgagaaaacattccgc
aaatgcgcgtttccgcgggcagcccaagctgctgatatttcaatcgcagcacttggaaat
gatgccggcgttatcggaggcgcttggatcgctaaaaatgaatggctgaaacatcaaaat
tgttaa

DBGET integrated database retrieval system