KEGG   Bacillus subtilis subsp. subtilis 168: BSU24860
Entry
BSU24860          CDS       T00010                                 

Symbol
yqgQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF910 Tup_N
Other DBs
NCBI-GeneID: 938210
NCBI-ProteinID: NP_390366
Pasteur: BG11684
BSORF: BG11684
UniProt: P54494 A0A6M3ZDT1
Structure
Position
complement(2571582..2571797)
AA seq 71 aa
MNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELE
QTKNGRDFYKG
NT seq 216 nt   +upstreamnt  +downstreamnt
atgaatacattttatgatgtgcagcagctgttaaaaacgtttggccacattgtttatttt
ggagacagagagcttgaaattgagtttatgctggatgaattaaaggaattatacatgaac
cacatgattgaaaaggagcagtgggccagagcggcagctgtccttcgaaaagaattggaa
caaacaaaaaacggaagagatttttataaaggctaa

DBGET integrated database retrieval system