KEGG   Bacillus subtilis subsp. subtilis 168: BSU24880
Entry
BSU24880          CDS       T00010                                 

Gene name
yqgO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938204
NCBI-ProteinID: NP_390368
Pasteur: BG11682
BSORF: BG11682
UniProt: P54492 A0A6M3ZE84
Position
complement(2573520..2573693)
AA seq 57 aa
MKKLLIYAIFAVSAVMFYQNRYRLMNTVLSQPGIRRSFIHLFLRIPFIRNKFIQQAF
NT seq 174 nt   +upstreamnt  +downstreamnt
atgaaaaaacttttgatatatgccattttcgcggtttctgccgtcatgttttatcaaaat
cgctaccgtcttatgaatactgtactcagccagccaggaatcaggcggtcttttatccat
ttgtttttaagaattccatttatccgcaataagtttatacagcaagctttctaa

DBGET integrated database retrieval system