KEGG   Bacillus subtilis subsp. subtilis 168: BSU24980
Entry
BSU24980          CDS       T00010                                 

Symbol
pstC
Name
(RefSeq) ABC transporter permease
  KO
K02037  phosphate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU24980 (pstC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU24980 (pstC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BSU24980 (pstC)
SSDB
Motif
Pfam: BPD_transp_1 DUF4064
Other DBs
NCBI-GeneID: 938184
NCBI-ProteinID: NP_390377
Pasteur: BG11376
BSORF: BG11376
UniProt: P46339 A0A6M4JLF7
Position
complement(2579717..2580646)
AA seq 309 aa
MINNRENMSVSERLISSRQNRQLDEVRGRMIVTACALIMIAASVAITIFLGVKGLQSFLV
NGVSPIEFLTSLNWNPTDSDPKYGVLPFIFGSFAVTILSALIAAPLGIAGAIFMTEIAPN
WGKKVLQPVIELLVGIPSVVYGFIGLTVLVPFIAQFKSSGTGHSLLAGTIVLSVMILPTI
TSISADAMASLPKSLREGSYALGATRWQTIRKVLVPAAFPTLMTAVVLGMARAFGEALAV
QMVIGNTRVLPESPFDTAGTLTTIITLNMGHTTYGSVENNTLWSMGLVLLVMSFLFILLI
RYLSSRRKV
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataaacaatagagaaaatatgtctgtgagcgagcgcttaatcagctctaggcaaaat
cggcaattggatgaagttcggggaagaatgatagtcacagcttgtgcactgattatgatt
gcggcatctgttgcgattaccattttcctcggcgttaaggggctgcaatcttttcttgta
aatggtgtaagcccaattgaattcttaacgagcttaaattggaatcctacagatagtgat
ccgaaatacggagtgctgccatttatttttggctcatttgcagtaacgattctttctgct
ctaatcgctgcgccgcttggcattgcaggtgcgatttttatgacagagattgccccgaat
tggggaaagaaagtgctgcagccggtgattgagcttttagtcggtattccatctgttgtt
tatggattcataggtcttacagtattggtgccgtttatcgcccagttcaaatcgagcgga
acagggcacagtttattggcgggaacgattgtcctttccgtcatgattctgccgacgatc
acatcgatttctgctgatgcaatggcttctcttccgaagagtttacgagagggttcttac
gcgcttggtgccacaagatggcagacgatcagaaaagtacttgtgcctgcagcttttcca
acattgatgacagctgttgtgttaggcatggctcgggcgttcggtgaagctttggctgtt
cagatggtcattggaaatacaagagtattgccggaaagcccgtttgacactgcgggaacg
ctgacaacgatcatcacgctgaatatgggccacaccacatacggaagtgttgaaaacaat
acgctgtggtcaatggggcttgtgcttctggtgatgtcattcttgttcatcctgcttatt
cgctacttgtcatctaggaggaaagtgtaa

DBGET integrated database retrieval system