KEGG   Bacillus subtilis subsp. subtilis 168: BSU24990
Entry
BSU24990          CDS       T00010                                 
Symbol
pstS
Name
(RefSeq) phosphate-binding protein PstS
  KO
K02040  phosphate transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU24990 (pstS)
  09132 Signal transduction
   02020 Two-component system
    BSU24990 (pstS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU24990 (pstS)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BSU24990 (pstS)
SSDB
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_1 SBP_bac_11 SBP_bac_8 LysR_substrate DUF4969
Other DBs
NCBI-GeneID: 938197
NCBI-ProteinID: NP_390378
Pasteur: BG11375
BSORF: BG11375
UniProt: P46338 A0A6M3ZDR0
Position
complement(2580715..2581617)
AA seq 300 aa
MKKNKLVLMLLMAAFMMIAAACGNAGESKKSNSDSAKGEEKASGSLTISGSSAMQPLVLA
AAEKFMEENPDADIQVQAGGSGTGLSQVSEGAVQIGNSDVFAEEKEGIDAKALVDHQVAV
VGMAAAVNPDAGVKDISKDELKKIFTGKIKNWKELGGKDQKITLVNRPDSSGTRATFVKY
ALDGAEPAEGITEDSSNTVKKIIADTPGAIGYLAFSYLTDDKVTALSIDGVKPEAKNVAT
GEYPIWAYQHSYTKGEATGLAKEFLDYLKSEDIQKSIVTDQGYIPVTDMKVTRDANGKQS
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaaaaaaaacaaattggtgcttatgcttctgatggctgcttttatgatgattgcagct
gcatgcggaaatgcaggagaaagtaaaaaatcgaatagcgattctgcaaaaggagaagaa
aaggcatcaggttctttaaccatttctggttcatcggcaatgcagccactagtacttgca
gccgcggaaaaatttatggaagaaaaccctgatgctgatatacaggtacaagctggcggt
tctggaacagggctttctcaagtctctgaaggagctgttcagatcgggaattcagacgtt
tttgctgaagaaaaagaaggcatcgatgcaaaagcgcttgtcgatcatcaagtcgctgta
gttggtatggcagcagctgtaaaccctgatgctggtgtaaaggatatttcaaaagatgaa
ttgaaaaaaatcttcactggcaaaatcaaaaactggaaagagctcggcggcaaagaccaa
aagattacacttgtaaaccgccctgattcttccggcacacgtgctacatttgtgaaatat
gcgcttgacggagcggagcctgcagaaggcattactgaagattcctccaacacggtgaaa
aagatcattgctgatactccgggagcgattggatatcttgcattctcatatttaacagat
gacaaagtaactgctctatctattgacggtgttaaacctgaagcgaaaaatgtagcaact
ggcgagtatccgatctgggcttatcaacattcttatacaaaaggtgaagcgacaggttta
gctaaagaatttcttgattatctaaagagtgaagacattcaaaaaagcattgttactgac
caaggctacattccggttactgatatgaaagtgacacgtgatgccaacgggaagcaaagc
tga

DBGET integrated database retrieval system