KEGG   Bacillus subtilis subsp. subtilis 168: BSU25000
Entry
BSU25000          CDS       T00010                                 

Gene name
pbpA
Definition
(RefSeq) hypothetical protein
  KO
K21465  penicillin-binding protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU25000 (pbpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU25000 (pbpA)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BSU25000 (pbpA)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-GeneID: 938199
NCBI-ProteinID: NP_390379
Pasteur: BG11678
BSORF: BG11678
UniProt: P54488 A0A6M4JME5
Position
complement(2581771..2583921)
AA seq 716 aa
MRRNKPKKQNHKEKKKSLPIRLNILFLAAFVIFTWIIVELGIKQIVQGDDYKNQANKQEQ
SEVSSAVPRGKIYDRNFNAIVTNKALNAITYTRSKSTTQEQRLKIAKKLSDMIKVDTKKV
TERDKKDYWILTRPKEAKKLISSKERQQVEDKKISDDDLYQLQLKRITDKQLNELTDKDM
QILAIKRQMDSGYALTPQYIKNEDVSAKEMAVVSEHLDELPGVDVTSDWEREYPYKNLLR
SVLGSVSSSNEGLPSNLLDHYLSLGYSRNDRVGKSYLEYQYESLLQGQKAKVENITDSKG
NVTGTKTVSEGKAGKDLVLTIDIDLQKSVEKIIEKKLKAAKARPSTELLDRAFVVMMDPR
NGEVLTMAGKQIKRENGAYKFDDYALGAMTSSYAMGSAVKGATVLTGLQTGAINLNTVFK
DEPLYIGQDKRGKKSWQNLGPVGIQTALEKSSNVFMFKTAIAVGKGEYKPHQALPLDTSA
FDTFRNYFSQFGLGVKTGIDLPNEMTGYKGTSRLSGFLLDFAIGQYDTYTPLELAQYVST
IANGGYRMKPQLVKEVRDSNAKKGIGAVVDSVQPEVLNKVDMKSSYIEEVQAGFRRVATK
GTAAGQLASASYKPAAKTGTAQSFYDGPDKSKTGTDTYNTTLVAYAPADNPEIAISVVVP
WTYIDYNQRYSITNEIGREVMDKYFELKSKQDKEGTQQKNKDKIEENAENTTSSDN
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgaggagaaataaaccaaaaaagcaaaatcataaagagaaaaagaagtcgcttccgatc
cggctgaatattttatttttagctgcctttgttatatttacctggattattgtggaactg
ggcatcaagcagatcgtgcaaggtgatgattacaaaaaccaagcgaataagcaggaacaa
agtgaagtcagctcagcggtaccacgcgggaaaatttatgatcgaaactttaatgccatt
gtgacaaataaggctttaaatgcaatcacatacacgagatctaaatcgaccacgcaagaa
cagcgcttaaagatcgcaaaaaagctgtctgacatgatcaaagtcgatacaaaaaaagta
acagaacgggataaaaaagattattggattttgactagaccgaaagaagcgaaaaagctc
attagctctaaagaaagacagcaggttgaagacaaaaaaatatccgatgacgatttatac
cagcttcagctaaaacggattactgataagcagctgaatgaattgacggataaagatatg
cagatccttgctatcaaaagacagatggattcgggctatgcattgacccctcaatatatc
aaaaacgaagatgtatcagcgaaggaaatggcagtggtaagtgaacatttagacgaactg
ccaggtgttgatgtcacgtccgattgggaacgtgaatatccttataaaaaccttcttcgc
tcagtgctcggaagtgtttccagctctaatgaaggattgccgtccaacttgctcgaccat
tatctgtcgcttggctacagccgaaatgacagggtcggaaaaagctatctggaataccaa
tatgaaagccttctgcagggccaaaaagcaaaagtcgaaaatatcacagattcaaaaggc
aatgtcacgggaacaaaaacggtatctgaaggcaaagccgggaaagatcttgtactaaca
attgatattgatttgcaaaaatcagtggaaaaaattattgagaaaaaacttaaagctgct
aaagcaagacctagtaccgaattgttggatcgtgcattcgttgtcatgatggaccctaga
aacggcgaagtgctgacaatggcagggaagcagattaaacgagaaaatggagcctataag
tttgatgattatgcattaggagccatgacttcatcctacgctatgggatcagctgtaaaa
ggtgcaaccgttttgaccggtcttcaaactggagcgattaatttgaatactgtatttaag
gatgaaccattgtatatcggccaggataaaagagggaaaaaatcttggcaaaacttaggg
ccggttggtattcaaactgcattagagaagtcatcaaacgtttttatgtttaaaacagca
attgcagttggtaaaggtgaatataaacctcaccaagcattgcctttggatacttctgca
tttgataccttcagaaattatttcagtcaatttggattaggagtaaaaacaggaattgat
ctaccaaatgaaatgacgggatataaaggtacaagcagattatctggtttcttgcttgat
ttcgccattggacagtatgatacttatacaccgctggaattggctcaatatgtctccacc
atagcaaatggtggctaccgcatgaagcctcagcttgtaaaggaagtcagagattcaaat
gcgaaaaaagggatcggcgcagtcgttgattctgttcagcctgaagtattgaataaagtc
gatatgaagagtagctatattgaagaggtccaagccggttttagacgggttgccactaaa
gggacagctgcaggtcaactggcttcagcatcgtataaaccagctgcaaaaacaggaaca
gcccaatcattttacgacggaccggataaatcaaaaacaggaacagacacttataatacg
acgcttgtggcttatgcaccagctgacaatcctgagattgctatttctgtcgtagttcct
tggacttacattgattacaatcaaagatactcaattacaaacgaaatcggcagggaagta
atggataaatattttgagctgaaatcgaagcaggacaaagaaggtactcagcaaaagaat
aaagacaaaattgaagaaaatgcagaaaacacaacgtcttctgataactaa

DBGET integrated database retrieval system