KEGG   Bacillus subtilis subsp. subtilis 168: BSU25010
Entry
BSU25010          CDS       T00010                                 

Symbol
yqgE
Name
(RefSeq) hypothetical protein
  KO
K08222  MFS transporter, YQGE family, putative transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU25010 (yqgE)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Putative YqgE transporter (YqgE) family [TC:2.A.1.33]
    BSU25010 (yqgE)
SSDB
Motif
Pfam: MFS_1 MFS_2 OATP
Other DBs
NCBI-GeneID: 938196
NCBI-ProteinID: NP_390380
Pasteur: BG11677
BSORF: BG11677
UniProt: P54487 A0A6M4JJH3
Position
complement(2584035..2585327)
AA seq 430 aa
MSKLKKVIGDVDVNKGLLFLLTIGGLYSLGIALSNTFVNVYLWKQSGKFIDLAIYNLSIV
TMQPITFYLAGRLAKKIDRVFILRFGVIFLAAFYLSVLLAGETAASRLVLIGAVLGVGYG
FYWLAFNVLTFEITEPDTRDFFNGFMGILSSSAGMIGPIVAGFVISRLENNTGYTVIFSL
SLSLFALAVVMSFFLKRRESKGRFMLSKVFGERHSNMNWRRITNAHFFQGLREGIFVFLI
SVFVFIETNSELALGTFGLVNSAVSFFAYYFASRLIKKKARKKSILLGGLILYGALFLIL
FHMSFSTLLTYGVFIAIGYPLLLVPYVSLTYDVIGRARHARKARIEYIVLREMFLNAGRI
VSILCFLLIVALLKEDVGIPLSLAILGIGHPLIYYFVKDIRFKEKEGENETMEEDGQKRV
TEPTLLKGER
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgagcaaactaaaaaaagtgataggcgatgtagacgtaaacaaaggcttactctttctg
ctgaccattggcgggctttactcgctgggaattgcactgtccaatacatttgttaatgtg
tatctttggaagcagtcagggaaatttattgatttggcgatatataatttatccattgtg
acaatgcagccgataaccttttatttggctggacggttagccaaaaaaatagacagggta
ttcattttaaggttcggcgtcatttttttagctgccttttatttaagtgtgcttttagcc
ggagaaacggcggccagccgcctcgtgctaatcggcgcggtgctcggagttggctatggc
ttttattggctagcgtttaacgtgctgacctttgaaataacagagccggatacacgagac
tttttcaacgggtttatgggcattctgtcttcctctgcaggaatgatcggcccgattgta
gccggattcgtgatctcaaggcttgaaaataatacgggttatacagtgattttcagtctc
tccctcagtttatttgccctggctgtcgtgatgagctttttcttaaaacggagagaatca
aagggccgttttatgctgagcaaagtatttggagagcgccatagcaatatgaattggcgg
agaatcacgaatgcgcatttttttcagggtttgagagaagggatttttgtctttttaatc
agtgtgtttgtatttattgagacaaacagcgagcttgctctcggtacattcggtcttgtc
aattcagctgtttccttctttgcctactactttgcatccaggctgattaagaaaaaggcg
agaaaaaaatcgattttgctgggcggacttattttgtatggcgcgctgtttttgattctg
ttccatatgagcttttcgacattattaacgtacggcgtttttattgccatcggctatcct
ctgttgcttgtgccatatgtatcacttacatatgatgtgatagggcgcgcgaggcatgcc
agaaaagcaagaattgaatatatcgtgcttagagaaatgttcttgaacgccggcagaatt
gtttccattttgtgctttctcctgattgtggcccttctgaaagaggatgtgggaattcct
ttgtcacttgcgatattgggtataggacatcctttgatttattactttgtcaaggatatt
cgttttaaggagaaagaaggggaaaatgaaaccatggaagaagacggccaaaaacgggta
acagaaccgacccttttaaaaggcgagagataa

DBGET integrated database retrieval system