KEGG   Bacillus subtilis subsp. subtilis 168: BSU25030
Entry
BSU25030          CDS       T00010                                 

Gene name
yqgC
Definition
(RefSeq) hypothetical protein
  KO
K09793  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU25030 (yqgC)
SSDB
Motif
Pfam: DUF456 DUF1269
Other DBs
NCBI-GeneID: 938138
NCBI-ProteinID: NP_390382
Pasteur: BG11675
BSORF: BG11675
UniProt: P54486 A0A6M3ZE37
Position
complement(2586221..2586703)
AA seq 160 aa
MDMLYWLLIAAVFIIAFIGLVYPVIPSVVFIVAGFVLYGFLFSFSPYSYMFWLVEAVFAA
VLFAADYVSNLLGVKRFGGSKAAIWGSTIGLLIGPFVIPVAGIILGPFIGAVCAELIVHQ
KDLKSAFKIGLGSLIGFLTGVIAKGIIQLLMIGYFLWTVL
NT seq 483 nt   +upstreamnt  +downstreamnt
atggatatgttgtattggctgttgattgcagcggtttttatcattgcctttatcgggctg
gtgtatcctgttattcctagcgtagtatttattgttgccggatttgtattgtacggattt
ttattttcattcagtccgtattcttatatgttctggcttgttgaggcagtttttgccgca
gtattattcgcagcagattacgtgtcgaatctgcttggagtaaaaaggttcggaggaagc
aaagctgccatatggggaagcacgatcggtttattaatcgggccttttgtcattccggtt
gcagggatcatattggggccgtttatcggggctgtttgcgcagaacttatcgtccatcag
aaggacttaaagtcagcgtttaaaattggcctcggctcactcattggttttttaacaggg
gttattgcaaagggcatcatacagcttttgatgatcggttactttttatggacggtccta
taa

DBGET integrated database retrieval system