KEGG   Bacillus subtilis subsp. subtilis 168: BSU25040
Entry
BSU25040          CDS       T00010                                 

Gene name
yqgB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1189 DUF3784
Other DBs
NCBI-GeneID: 937983
NCBI-ProteinID: NP_390383
Pasteur: BG11674
BSORF: BG11674
UniProt: P54485 A0A6M3ZJ35
Position
2586813..2587580
AA seq 255 aa
MNVFQLFIKSTYSPRDIAKTRFQGIGKAILYVFLLSVLFAIPTAYYVSTGTVKSMNGFKT
VLNKDFPDFTISNGKLQTDEKKATESQANGFVIVFDPTDSYGTEQIEAKQNAIGILQNKF
VLAIDGQAQEMSYSMMPSELQKKDVIAGLNQNKAMIVTVLSALIFLVTAAGKFIEVSFLA
LIGLIIKNSQKKHLSYHQLWKLSAYSITLSTVFFTIMRALEATVPSEFLLNWFVNFVILF
LVLKEIPSKKVINKS
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgaatgtgtttcagcttttcattaaaagtacatactctccccgtgatattgcaaaaaca
agatttcaaggaatcggaaaagcgattctttatgtatttttgctctctgtcctgtttgca
atccctaccgcttattatgtaagtacagggaccgtaaaatcaatgaacggctttaaaact
gttttaaacaaagatttccctgatttcacaatttcaaacggcaaacttcaaacggatgag
aaaaaagccacggaatctcaggcaaatggtttcgttatcgtgttcgatccgacagactcc
tatggcactgaacaaattgaagcaaagcaaaacgcaatcggcatccttcagaacaaattt
gttttggccattgacggacaagcccaagaaatgtcttactcaatgatgccgtcagagtta
cagaaaaaagatgtcattgcaggtttaaaccaaaataaagcgatgattgtaactgttctc
tcagctcttatttttctcgtaacagcagcgggaaaatttattgaagtatcgtttttagcg
cttatcgggttaatcattaagaattcgcagaaaaaacatttatcctatcatcagctctgg
aagctttctgcttattccatcacactttcaactgtattctttacaatcatgcgggcacta
gaagcaaccgtaccaagtgaatttttgctgaactggtttgtcaattttgtcatcctgttt
ctcgttttaaaagagattccgtccaaaaaagtaattaataaaagttaa

DBGET integrated database retrieval system