KEGG   Bacillus subtilis subsp. subtilis 168: BSU25050
Entry
BSU25050          CDS       T00010                                 

Symbol
yqgA
Name
(RefSeq) cell wall-binding protein YqgA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937963
NCBI-ProteinID: NP_390384
Pasteur: BG11673
BSORF: BG11673
UniProt: P54484 A0A6M4JJ58
Position
complement(2587996..2588424)
AA seq 142 aa
MKQGKFSVFLILLLMLTLVVAPKEKAEAASSGWQPVSGISGCKIRVITDAYTYTKSATSI
DAYAETNGKCGKLNYKSFGVSIVEGGDIGPQYSGYFSSRTPTKKFYFSKLPKPTGTPWAV
GLSVYKGKAKGAAFVYINPQKR
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaagcaaggaaaattttctgtgtttttaattttgctactaatgttaactttggtagtt
gcacctaaagaaaaagcagaggctgcaagcagtggttggcaaccggtaagtggtatttct
ggttgtaaaataagagttattacagatgcttatacatatactaagagtgcaacatctatt
gatgcttacgccgaaacaaatggaaaatgcggtaaactaaattataagagctttggtgta
tctatagttgagggtggggacattggcccgcaatattcagggtacttttcaagtagaact
ccaaccaaaaagttttacttcagtaaattaccaaaaccgacaggaacaccttgggcagta
ggtttatcagtatataaggggaaagctaagggagctgcatttgtatacataaacccacaa
aaaagataa

DBGET integrated database retrieval system