KEGG   Bacillus subtilis subsp. subtilis 168: BSU25060
Entry
BSU25060          CDS       T00010                                 

Symbol
yqfZ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysM FloA
Other DBs
NCBI-GeneID: 938027
NCBI-ProteinID: NP_390385
Pasteur: BG11672
BSORF: BG11672
UniProt: P54483 A0A6M3ZDV4
Position
2588701..2589000
AA seq 99 aa
MKRLTLVCSIVFILFILFYDLKIGTIPIQDLPVYEASAKTAVQEPAYKTVKVKPGDTVMS
IVGSAGSPDDIVKDFEALNPNVKANAIQAGTAYKFPVYP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaagcgtctcaccttagtatgcagcattgtttttatactttttattcttttttatgac
cttaaaattggaaccatacccattcaggacctccctgtctatgaagcatcagcaaaaacg
gctgtacaagaaccggcttataaaacggtgaaggtaaagccgggtgatacggttatgtcg
atagtcggatcagcaggttctccggatgacattgtaaaggattttgaagcactgaatcca
aatgtgaaagctaacgccattcaagccggaacagcgtataaattcccggtctacccttaa

DBGET integrated database retrieval system