KEGG   Bacillus subtilis subsp. subtilis 168: BSU25070
Entry
BSU25070          CDS       T00010                                 

Symbol
ispG
Name
(RefSeq) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)
  KO
K03526  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU25070 (ispG)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     BSU25070 (ispG)
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     BSU25070 (ispG)
SSDB
Motif
Pfam: GcpE CusB_dom_1 zf-RING_7
Other DBs
NCBI-GeneID: 937984
NCBI-ProteinID: NP_390386
Pasteur: BG11671
BSORF: BG11671
UniProt: P54482 A0A6M3ZE63
Position
2589123..2590256
AA seq 377 aa
MQVSEITHRTKTRPVKVGPLTIGGNNEVVIQSMTTTKTHDVEATVAEINRLAEAGCQIVR
VACPDERAANAIADIKKRISIPLVVDIHFDYKLALKAIEGGADKIRINPGNIGRREKVEA
VVKAAKDKGIPIRIGVNAGSLEKRILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSM
KASDVNLAIEAYEKAAKAFDYPLHLGITESGTLFAGTVKSAAGLGAILSKGIGNTMRISL
SADPVEEVKVARELLKSFGLASNAATLISCPTCGRIEIDLISIANEVEEYISKIKAPIKV
AVLGCAVNGPGEAREADIGIAGARGEGLLFRKGKIVRKVPEETMVEELKKEIDILAEEHY
AKLEAEKAKLKEETQKA
NT seq 1134 nt   +upstreamnt  +downstreamnt
ttgcaagtgagtgaaatcacacatcgtacaaaaacgcgtcccgtcaaagtgggaccttta
acaataggcggcaacaatgaagttgtcatccaaagcatgacaacaacaaaaacacatgat
gtagaagcaacggttgcggaaattaaccgtttggctgaagccggatgccaaatcgttcgg
gtagcatgtccggatgaacgggcggcaaacgccattgcggatattaaaaagcgcatttcc
attcctctcgttgttgacatacatttcgattataaacttgcgttgaaagccattgaaggc
ggcgcagataaaatccgaatcaaccccggcaatatcggccggcgcgaaaaagttgaagcg
gttgttaaagcggccaaagacaaaggcattccgatcagaatcggagtaaacgccggttca
ttggaaaaacggattttagaaaaatacggttatccgactgccgatggaatggtagaaagc
gcacttcatcacattaaaattcttgaggatcttgattttcacgatattattgtcagcatg
aaggcctctgacgtgaaccttgcaatcgaggcttatgaaaaagcagcgaaagcgtttgac
tacccgcttcacctcgggatcaccgagtcaggaacactgtttgccggcacagtaaagagc
gcagcaggactcggcgccattttaagcaaaggcatcgggaacaccatgcgcatttcacta
agcgcagaccctgtagaagaggtaaaagtagcaagggagcttctgaaatctttcggctta
gcctccaatgctgccacgctcatctcatgcccgacttgcggccgtattgagattgatcta
atcagcattgccaatgaagtggaagagtatatttctaagataaaagcgccgattaaagtt
gctgttctcggctgcgctgtaaacggacctggtgaagcgagagaagctgatatcggaatc
gccggcgcacgcggtgaagggctgctgttccggaaagggaaaattgtccgtaaggttcca
gaggaaacgatggtagaagaactcaaaaaagaaattgacattcttgctgaggaacactac
gcaaaacttgaagctgaaaaagcaaaattaaaagaagaaacacaaaaagcttga

DBGET integrated database retrieval system