KEGG   Bacillus subtilis subsp. subtilis 168: BSU25080
Entry
BSU25080          CDS       T00010                                 

Symbol
yqfX
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4190 CrgA
Other DBs
NCBI-GeneID: 937973
NCBI-ProteinID: NP_390387
Pasteur: BG11670
BSORF: BG11670
UniProt: P54481 A0A6M4JLH0
Position
complement(2590282..2590671)
AA seq 129 aa
MKVANDYEKRDNNSYYVDHGSEGTNITRDNDGFFEETAAEIAEPYRAADRSNDQDNDRSG
GNVNEGRGIGYIALALSIISLFVLPVLLGAAGIIVGYIARRRGAQGLGAWAMGIGVVSLV
LGIFIIPFF
NT seq 390 nt   +upstreamnt  +downstreamnt
ttgaaggtggcaaacgattacgaaaagcgtgataacaacagttactatgttgatcatgga
tctgaagggacaaatattacccgcgacaatgacggtttttttgaggaaacagctgctgaa
atcgcagagccttatcgtgctgctgaccgcagcaatgaccaagacaatgatcgcagcggc
ggcaatgtcaatgaaggacggggaatagggtacatcgctttagccttgtccatcatttca
ttgtttgtactgcctgttttattgggagctgctggtattattgtcggctatatcgcaaga
agaagaggtgctcaaggccttggagcctgggcaatgggtatcggtgtcgtttcattagtg
cttggaatatttattattccatttttctaa

DBGET integrated database retrieval system