KEGG   Bacillus subtilis subsp. subtilis 168: BSU25090
Entry
BSU25090          CDS       T00010                                 

Symbol
yqfW
Name
(RefSeq) nucleotidase YqfW
  KO
K05967  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU25090 (yqfW)
SSDB
Motif
Pfam: Acid_phosphat_B 5-nucleotidase ANT Peripla_BP_4
Other DBs
NCBI-GeneID: 937915
NCBI-ProteinID: NP_390388
Pasteur: BG11669
BSORF: BG11669
UniProt: P54480 A0A6M3ZDS0
Position
2590804..2591385
AA seq 193 aa
MLRLGIDIDGTITAQDTFVPYLNRSFNLSISLNDMTDYDLTKLLNITQEEFWDWMNQNEA
IIYKEALLAQHAKQSLDLLKEEHKLIYITARRTHLTDITYEWFDRQNIHYDHIELVGGHH
KVEAVKNHNIDLFFEDHHGNAMMIAKEAGIPVILFNSPYNQLPIDSNIIRVNNWLEAVQW
MNNNKHHLIRVNN
NT seq 582 nt   +upstreamnt  +downstreamnt
atgttacgcttaggaatagatattgacggcacaatcacggctcaggatacattcgtccct
tatttgaaccgttcgtttaatctttccatttcattaaacgatatgacggattatgattta
acaaagctgttaaacattacccaggaagaattttgggattggatgaatcaaaatgaagcg
atcatatataaggaagcattgcttgcacagcatgcgaaacagtctctcgatcttctcaaa
gaggagcacaagcttatttatattacagcgagacggactcatttaactgatattacttat
gaatggtttgacagacaaaacattcattatgaccacatcgaacttgttgggggtcatcac
aaagttgaagcggtcaagaatcataacatcgacctgttttttgaggatcatcacgggaac
gccatgatgattgcgaaagaagccgggataccggtgattttgttcaattccccttataat
cagcttccgattgattcaaacatcatcagagtaaacaactggctagaagccgttcaatgg
atgaacaacaacaagcatcacttaatacgcgtcaataactga

DBGET integrated database retrieval system