KEGG   Bacillus subtilis subsp. subtilis 168: BSU25100
Entry
BSU25100          CDS       T00010                                 

Gene name
zur
Definition
(RefSeq) zinc-specific metallo-regulatory protein
  KO
K02076  Fur family transcriptional regulator, zinc uptake regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU25100 (zur)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    BSU25100 (zur)
SSDB
Motif
Pfam: FUR Prok-RING_4
Other DBs
NCBI-GeneID: 937968
NCBI-ProteinID: NP_390389
Pasteur: BG11668
BSORF: BG11668
UniProt: P54479 A0A6M4JME9
Position
complement(2591428..2591865)
AA seq 145 aa
MNVQEALNLLKENGYKYTNKREDMLQLFADSDRYLTAKNVLSALNDDYPGLSFDTIYRNL
SLYEELGILETTELSGEKLFRFKCSFTHHHHHFICLACGKTKEIESCPMDKLCDDLDGYQ
VSGHKFEIYGTCPDCTAENQENTTA
NT seq 438 nt   +upstreamnt  +downstreamnt
atgaacgtccaagaagcgctgaacctattaaaagaaaacggatataaatatacaaacaaa
cgggaggatatgctgcagctttttgctgattcagacagatatcttaccgctaaaaacgta
ctgtctgcactgaatgatgattatccaggcttaagctttgatacaatctacagaaatctt
tctttatatgaagaacttgggattttggaaacaactgagctgtccggtgaaaagctcttc
cgatttaagtgttcattcacccatcaccaccatcattttatttgtcttgcctgcggcaaa
acaaaggaaattgaatcatgtccgatggacaagctttgtgatgatttggatggctatcag
gtcagcgggcataaatttgagatttatggcacatgccctgattgtacagcggaaaaccaa
gaaaacactactgcgtaa

DBGET integrated database retrieval system