KEGG   Bacillus subtilis subsp. subtilis 168: BSU25120
Entry
BSU25120          CDS       T00010                                 

Symbol
yqfT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2624 DUF3102
Other DBs
NCBI-GeneID: 937909
NCBI-ProteinID: NP_390391
Pasteur: BG11666
BSORF: BG11666
UniProt: P54477 A0A6M4JNP7
Position
2593000..2593254
AA seq 84 aa
MILFQRIILQRLNQATADDLLKYSKQYGISLTRSQAVEVANLLYGKNVNIFNESERMRLL
KQVETITSKETAQTVNELFKQFTS
NT seq 255 nt   +upstreamnt  +downstreamnt
atgattttatttcaaagaattattttgcagcggcttaatcaggctactgctgatgatttg
ctgaagtactcaaaacaatacggaatcagcttaacaagatcgcaggccgttgaagtagcg
aacctgttatacgggaaaaatgtaaacatctttaatgagagtgaacgaatgcggctgctg
aaacaagtagagacgattacatcgaaagaaacagctcaaacagttaatgaactattcaaa
caatttacaagctaa

DBGET integrated database retrieval system