KEGG   Bacillus subtilis subsp. subtilis 168: BSU25160
Entry
BSU25160          CDS       T00010                                 

Symbol
ispH
Name
(RefSeq) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU25160 (ispH)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     BSU25160 (ispH)
SSDB
Motif
Pfam: LYTB E3_binding
Other DBs
NCBI-GeneID: 937900
NCBI-ProteinID: NP_390395
Pasteur: BG11662
BSORF: BG11662
UniProt: P54473 A0A6M3ZDW4
Position
2596535..2597479
AA seq 314 aa
MDVIKISPRGYCYGVVDAMVIAKNASLDKSLPRPIYILGMIVHNKHVTDAFEEEGIFTLD
GSNRLDILKQVDKGTVIFTAHGVSPEVRRIAEEKGLVAIDATCPDVTKTHNLILEMKEKG
YHVIYIGKKGHPEPEGAVGVAPEIVHLVETEEDVKNLDIQSEKLIVTNQTTMSQWDVHDI
MELVKEKYPHVEYHQEICLATQVRQEAVSEQAKKADLTIVVGDPKSNNSNRLAQVSEEIA
GTKAYRIGDLSELKLEWLKGVNTVAVTAGASTPTPITKEVIRFLEQFDHEDPSTWTTEHN
IPLKKILPKVKAKN
NT seq 945 nt   +upstreamnt  +downstreamnt
atggacgtaattaaaatttcaccgcgcggctattgctatggtgttgttgatgctatggtc
attgccaaaaatgcgtcgctagataaaagcttgccaagacccatctatatactcgggatg
attgttcataataaacacgtcactgatgcgtttgaagaggaagggatttttacattggac
ggctctaaccgtctggacatcttaaagcaggttgacaaaggaactgtcattttcactgcg
cacggtgtttctcccgaagtcagaagaatcgcagaagaaaaagggttagtcgcaattgat
gctacatgtccggatgtgacaaaaactcataatctaatcttagagatgaaagaaaaagga
tatcacgtgatctatatcggcaaaaaagggcatccagagcctgagggagccgttggcgta
gcgccggagatcgttcacttagttgaaacagaagaagatgtaaagaaccttgatatccaa
tctgagaagttaatcgtgacgaatcaaacaacaatgtctcaatgggatgttcacgacatt
atggagcttgtcaaagaaaaatatcctcatgtcgaatatcaccaagagatttgcctcgct
actcaagtgcggcaggaagctgtatcagagcaggcaaaaaaagcggacttaacaatcgtt
gtcggagacccgaaaagcaacaattcaaataggcttgctcaagtgtcagaggaaatagcc
gggacaaaagcataccggatcggcgacttaagcgaattgaagctcgaatggctgaaaggc
gttaataccgttgcagttacagcgggagcttcaacaccgacgccgatcacaaaagaagtc
attcgctttttagagcagtttgatcacgaagatccatcaacttggacaactgaacataat
ataccgctcaaaaaaatacttccaaaagtaaaagcaaaaaactga

DBGET integrated database retrieval system