KEGG   Bacillus subtilis subsp. subtilis 168: BSU25170
Entry
BSU25170          CDS       T00010                                 

Symbol
yqfO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NIF3
Other DBs
NCBI-GeneID: 937901
NCBI-ProteinID: NP_390396
Pasteur: BG11661
BSORF: BG11661
UniProt: P54472 A0A6M3ZE75
Position
complement(2597502..2598623)
AA seq 373 aa
MAKSVNGQQIIQLFEQFSPKAYAVEGDKIGLQIGTLNKPIKNVMVTLDVLESVIDEAIEK
EVDLIIAHHPPIFRSLKHISTDQPAGRLIEKCLKHDIAVYAAHTNLDVADGGVNDLLAEA
LELSETEVLAPTYTDPLKKLAVYVPKEYEEQVRAALGNAGAGHIGEYSHCAFSSEGIGSF
KPLDGAKPFIGEVGELELVHEVRLETVFPKSVEKAVINAMIKSHPYEEVAYDIYPVEQTP
AEKGLGRVGTLKNEMTLKEFALFVKDKLDVNGVRMVGDADSMVKKVAVLGGDGNKYIHHA
KRKGADVYVTGDLYFHVAHDAMMLGLNVVDPGHYAEKIMKEGVTRKLTSMCNDKKFGVNI
FVSETDTNPFTFL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggctaaaagtgtaaatgggcagcagatcatccagctgtttgaacaattttccccgaaa
gcctatgcggttgaaggagataaaatcggcctgcaaatcggcaccttaaacaaaccaatt
aaaaatgtgatggttacacttgatgtgttagagagcgttatcgatgaagcgattgaaaaa
gaggttgacttgattattgcacaccatccaccaattttccggtcgctaaagcatatttca
acagatcagcctgccggaaggttaattgaaaagtgtttgaagcatgatattgctgtttat
gcagctcatacaaatttagacgttgcggacggcggtgtgaatgatttgcttgctgaagca
ttagagctgagtgagacggaagtgctggcacctacttatacggatcctctgaaaaagctg
gcagtttacgtgccgaaggaatatgaagagcaggtcagagccgcgctcggaaatgcgggg
gccggccatatcggtgaatacagccattgcgcgttttcatctgaaggaatcggcagcttt
aagccattggacggagctaagccttttatcggtgaagtgggagagcttgagcttgttcat
gaagtaaggcttgagactgtatttcctaaaagcgtcgaaaaggctgttatcaatgcaatg
ataaaaagccatccatatgaagaagtcgcttacgatatctatcctgtcgaacagactccc
gccgaaaaagggctcggccgtgtcggaacccttaaaaatgagatgacgctcaaggaattc
gctttatttgtgaaagacaagcttgacgtcaatggtgtcagaatggttggggatgctgac
agcatggtgaaaaaagtagctgttcttggcggagatggaaacaagtatattcatcatgca
aaacgaaagggagccgatgtttacgtcacaggagatttatacttccatgtggcccatgat
gcgatgatgcttggcctaaatgtggttgatccgggccattacgcggaaaaaatcatgaaa
gaaggcgtcacgagaaaacttacatcaatgtgtaatgataaaaagtttggcgtgaatatc
tttgtttctgaaacagatacaaatccatttacatttctataa

DBGET integrated database retrieval system