KEGG   Bacillus subtilis subsp. subtilis 168: BSU25180
Entry
BSU25180          CDS       T00010                                 
Symbol
trmK
Name
(RefSeq) tRNA: m1A22 methyltransferase
  KO
K06967  tRNA (adenine22-N1)-methyltransferase [EC:2.1.1.217]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU25180 (trmK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.217  tRNA (adenine22-N1)-methyltransferase
     BSU25180 (trmK)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    BSU25180 (trmK)
SSDB
Motif
Pfam: TrmK Methyltransf_18
Other DBs
NCBI-GeneID: 937898
NCBI-ProteinID: NP_390397
Pasteur: BG11660
BSORF: BG11660
UniProt: P54471
Structure
Position
complement(2598616..2599266)
AA seq 216 aa
MADIGSDHAYLPCYAVLNHKASGAIAGEITDGPFLSAKRQVEKSGLNSHISVRQGDGLEV
IKKGEADAITIAGMGGALIAHILEAGKDKLTGKERLILQPNIHAVHIREWLYKERYALID
EVILEEDGKCYEVLVAEAGDRDAAYDGISLSAGMLVGPFLAKEKNAVFLKKWTQELQHTQ
SIYEQISQAADTEQNKQKLKELADRMELLKEVIDHG
NT seq 651 nt   +upstreamnt  +downstreamnt
atggccgatatcggctctgaccacgcctaccttccttgttatgcggtgctgaatcataaa
gccagcggggcgattgccggagaaataacagacggcccatttttgtctgcaaagcggcag
gttgaaaaatcaggcttaaactcgcacatttctgtaaggcagggagacggactggaagtg
attaaaaaaggtgaagctgatgccattacgattgccggaatgggcggggctttgatcgct
cacattttagaagcgggcaaagacaaattaacggggaaggaacggctcattttacagccg
aatattcatgctgttcatatcagggagtggctttataaagaaagatatgcgctgatagat
gaggtaatccttgaagaggacggaaagtgctatgaggtgctggtggcagaagcgggagac
agggatgcggcttatgacggtatttctttatcagccgggatgctcgttggccctttcttg
gcaaaagaaaaaaatgctgtctttttgaaaaagtggacacaagagcttcagcacactcaa
agcatttatgaacagatcagccaagcggcggatacagagcaaaacaaacaaaaattaaag
gagctcgccgatcgaatggagctgttaaaggaggtaatcgatcatggctaa

DBGET integrated database retrieval system