KEGG   Bacillus subtilis subsp. subtilis 168: BSU25190
Entry
BSU25190          CDS       T00010                                 

Symbol
cccA
Name
(RefSeq) cytochrome c-550
  KO
K13300  cytochrome c550
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU25190 (cccA)
SSDB
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-GeneID: 937902
NCBI-ProteinID: NP_390398
Pasteur: BG10315
BSORF: BG10315
UniProt: P24469 A0A6M4JLV6
Position
complement(2599523..2599885)
AA seq 120 aa
MKWNPLIPFLLIAVLGIGLTFFLSVKGLDDSREIASGGESKSAEKKDANASPEEIYKANC
IACHGENYEGVSGPSLKGVGDKKDVAEIKTKIEKGGNGMPSGLVPADKLDDMAEWVSKIK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaatggaacccgcttattccatttttgctgatcgctgttttaggaattggtctaact
ttctttttatcagtaaaaggacttgatgactctcgggagattgcgagcggaggagaaagc
aaatctgctgaaaagaaagatgcaaacgcttcaccagaagaaatttacaaggcaaactgc
atcgcatgccacggtgaaaattatgaaggtgtttcgggtcctagcttaaaaggtgtaggg
gataagaaagatgtcgctgaaattaaaacaaagatcgaaaaaggcggtaatggaatgcct
tccggtcttgttccggccgataagctggatgatatggcagagtgggtgtcaaaaattaaa
taa

DBGET integrated database retrieval system