KEGG   Bacillus subtilis subsp. subtilis 168: BSU25210Help
Entry
BSU25210          CDS       T00010                                 

Gene name
dnaG
Definition
(RefSeq) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU25210 (dnaG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU25210 (dnaG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     BSU25210 (dnaG)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BSU25210 (dnaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 Toprim_2 Toprim_4 DnaB_bind Toprim_3 Toprim DnaB DUF3854 RecX PepX_N
Motif
Other DBs
NCBI-GeneID: 937899
NCBI-ProteinID: NP_390400
Pasteur: BG10313
BSORF: BG10313
UniProt: P05096
Structure
PDB: 

Position
complement(2601528..2603339)
Genome map
AA seq 603 aa AA seqDB search
MGNRIPDEIVDQVQKSADIVEVIGDYVQLKKQGRNYFGLCPFHGESTPSFSVSPDKQIFH
CFGCGAGGNVFSFLRQMEGYSFAESVSHLADKYQIDFPDDITVHSGARPESSGEQKMAEA
HELLKKFYHHLLINTKEGQEALDYLLSRGFTKELINEFQIGYALDSWDFITKFLVKRGFS
EAQMEKAGLLIRREDGSGYFDRFRNRVMFPIHDHHGAVVAFSGRALGSQQPKYMNSPETP
LFHKSKLLYNFYKARLHIRKQERAVLFEGFADVISAVSSDVKESIATMGTSLTDDHVKIL
RRNVEEIILCYDSDKAGYEATLKASELLQKKGCKVRVAMIPDGLDPDDYIKKFGGEKFKN
DIIDASVTVMAFKMQYFRKGKNLSDEGDRLAYIKDVLKEISTLSGSLEQEVYVKQLASEF
SLSQESLTEQLSVFSKQNKPADNSGETKTRRAHLTTKARQKRLRPAYENAERLLLAHMLR
DRSVIKKVIDRVGFQFNIDEHRALAAYLYAFYEEGAELTPQHLMARVTDDHISQLLSDIL
MLQVNQELSEAELSDYVKKVLNQRNWSMIKEKEAERAEAERQKDFLRAASLAQEIVTLNR
SLK
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcggataccagatgaaattgtggatcaggtgcaaaagtcggcagatatcgtt
gaagtcataggtgattatgttcaattaaagaagcaaggccgaaactactttggactctgt
ccttttcatggagaaagcacaccttcgttttccgtatcgcccgacaaacagatttttcat
tgctttggctgcggagcgggcggcaatgttttctcttttttaaggcagatggaaggctat
tcttttgccgagtcggtttctcaccttgctgacaaataccaaattgattttccagatgat
ataacagtccattccggagcccggccagagtcttctggagaacaaaaaatggctgaggca
catgagctcctgaagaaattttaccatcatttgttaataaatacaaaagaaggtcaagag
gcactggattatctgctttctaggggctttacgaaagagctgattaatgaatttcagatt
ggctatgctcttgattcttgggactttatcacgaaattccttgtaaagaggggatttagt
gaggcgcaaatggaaaaagcgggtctcctgatcagacgcgaagacggaagcggatatttc
gaccgcttcagaaaccgtgtcatgtttccgatccatgatcatcacggggctgttgttgct
ttctcaggcagggctcttggcagccagcagcctaagtatatgaacagtcctgaaaccccg
ctctttcataaaagcaaactgctttacaatttttataaggcccgccttcatatcagaaag
caggaaagagcagtcttatttgaagggtttgctgatgtcatatcggccgtaagctcggat
gtaaaggaaagcatagccacgatgggaacgtctcttacagatgatcatgtcaagatcctg
agaagaaacgtcgaagaaatcattctttgctatgactctgataaagccggttatgaagcc
accttaaaagcttcggagcttctgcaaaaaaaaggctgcaaagtcagagttgcaatgatt
cctgacggattggaccctgatgattacatcaaaaaattcggcggggaaaaatttaaaaac
gacattattgacgcaagtgtcaccgtaatggcgttcaaaatgcaatatttccgaaaagga
aagaacctgtccgatgaaggcgaccgcctagcttacattaaagacgtactgaaagaaatc
agcacgctttcagggtctctagagcaggaagtctatgtaaagcagcttgcttcagagttt
tcgctttcacaggagtctttaactgagcagctgtctgttttcagcaagcaaaacaaacct
gctgacaatagcggtgaaactaaaacgcggcgagcgcatctgacgacaaaagcaaggcaa
aaacgtttgcgtccggcgtatgaaaatgcagaaaggctgttactcgctcacatgcttcga
gatcggagcgtcatcaaaaaagtgattgaccgggtagggtttcaatttaatattgatgag
caccgggcattagccgcttatctttatgctttttatgaagagggagccgagctgacgcct
cagcatctgatggccagggtgacggatgatcatataagccagctcttgtccgatatatta
atgcttcaggttaatcaagagcttagcgaagccgagttatcagattatgtaaaaaaagtg
ttgaatcaaagaaattggtcaatgataaaagaaaaagaggcggaaagagccgaagcagaa
aggcaaaaagattttttaagagctgcttctttggctcaagaaatcgttacattgaaccga
tctttaaaataa

DBGET integrated database retrieval system