KEGG   Bacillus subtilis subsp. subtilis 168: BSU25220
Entry
BSU25220          CDS       T00010                                 

Symbol
antE
Name
(RefSeq) protein AntE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 2914189
NCBI-ProteinID: YP_054587
Pasteur: BG14178
BSORF: BG14178
UniProt: Q7WY63
Position
2602979..2603275
AA seq 98 aa
MPQPFFVLQKTLAGLRNGLLYHLENQFGICQQGEKPTRQKNSLPSALKKRKHCRPLRSQS
NEKSVCRAIRKTKVCFLHEKDRVQSSFGLASLIEHNHL
NT seq 297 nt   +upstreamnt  +downstreamnt
gtgcctcagccattttttgttctccagaagactctggccgggctccggaatggactgtta
tatcatctggaaaatcaatttggtatttgtcagcaaggtgagaaaccgactcggcaaaag
aatagccttccatctgccttaaaaaagagaaaacattgccgcccgctccgcagccaaagc
aatgaaaaatctgtttgtcgggcgatacggaaaacgaaggtgtgctttctccatgaaaag
gacagagtccaaagtagtttcggccttgcttctttaattgaacataatcacctatga

DBGET integrated database retrieval system