KEGG   Bacillus subtilis subsp. subtilis 168: BSU25230Help
Entry
BSU25230          CDS       T00010                                 

Gene name
yqxD
Definition
(RefSeq) hypothetical protein
  KO
K09768  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU25230 (yqxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF188 PIN_9 CTC1
Motif
Other DBs
NCBI-GeneID: 937896
NCBI-ProteinID: NP_390401
Pasteur: BG10312
BSORF: BG10312
UniProt: P17868
Position
complement(2603373..2603867)
Genome map
AA seq 164 aa AA seqDB search
MEGWRITLLNEQEKTIFVDADACPVKDEILQTASEYEVQVLFVASFEHYQLSRSNEEKWK
YVDPHKEAADLYIANHVKPGDIVVTQDIGLASLLLNRNVSVMSERGRLYKEDTIDFALEG
RHFSGKQRRKGVYAKGPKKLNKEDRERFITLLQKILSNDEGILH
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggagggatggagaattactcttcttaatgaacaagaaaagacgatttttgtcgatgct
gatgcttgtccggtaaaagatgaaattttacaaacagcatccgagtatgaagttcaagtt
ctttttgtcgcttcatttgaacattatcagctttccagaagcaatgaagaaaaatggaag
tatgttgatcctcataaagaagctgctgatttatatatcgcaaatcacgtgaaaccggga
gatattgttgtgacgcaggacatcggattagcatctctgctgttgaacagaaatgtctct
gttatgtcggaaagaggtcgtctttacaaggaagacacgattgattttgccctagagggc
cgtcatttttccggcaaacaaagaagaaaaggcgtatatgccaaagggcctaaaaaattg
aataaagaagatcgagaacgatttattacactgctgcaaaaaatcctgtcgaacgatgaa
gggattttgcactaa

DBGET integrated database retrieval system