KEGG   Bacillus subtilis subsp. subtilis 168: BSU25240Help
Entry
BSU25240          CDS       T00010                                 

Gene name
yqfL
Definition
(RefSeq) hypothetical protein
  KO
K09773  [pyruvate, water dikinase]-phosphate phosphotransferase / [pyruvate, water dikinase] kinase [EC:2.7.4.28 2.7.11.33]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU25240 (yqfL)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.28  [pyruvate, water dikinase]-phosphate phosphotransferase
     BSU25240 (yqfL)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.33  [pyruvate, water dikinase] kinase
     BSU25240 (yqfL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kinase-PPPase DUF2951 IF-2
Motif
Other DBs
NCBI-GeneID: 937889
NCBI-ProteinID: NP_390402
Pasteur: BG11659
BSORF: BG11659
UniProt: P54470
Position
complement(2604121..2604933)
Genome map
AA seq 270 aa AA seqDB search
MNNRIIYVVSDSVGETAELVVKAALSQFNGSADDTHVRRIPYVEDIGTINEVISLAKADG
GIICFTLVVPEIREYLIAEAEKANVLYYDIIGPLIDKMETAYGLTAKYEPGRVRQLDEDY
FKKVEAIEFAVKYDDGRDPRGILKADIVLIGVSRTSKTPLSQYLAHKRLKVANVPIVPEV
DPPEELFNVDPKKCIGLKISPDKLNHIRKERLKSLGLNDKAIYANINRIKEELEYFEKIV
DRIGCQVVDVSNKAVEETANIIHHLKTKNI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccgcatcatctatgttgtatcggattccgtcggtgaaacggctgaattggta
gtaaaagcagcactcagccaatttaacggatcggcggatgatactcatgtaagaagaatt
ccttatgttgaagatataggcactatcaatgaagtgatttcacttgcaaaggcagacggc
ggcattatctgttttacactcgtggtgccggaaatcagagaatatttgatagccgaagcg
gaaaaagcaaatgttttatattatgatattatcggcccgttgattgataaaatggaaaca
gcctacggtttaacagcgaaatacgaaccggggcgggtgcgccagcttgatgaagattat
ttcaaaaaagtggaggccatcgagtttgcagttaaatacgatgatggacgtgatccaaga
gggattttaaaagctgatatcgttttgatcggcgtgtcaagaacgtctaaaacaccgctg
tctcaatatctcgcacacaaacgcctgaaggttgccaatgttccgattgtaccggaggtt
gatccgccggaagaactctttaacgttgatccgaaaaaatgcatcggtttaaagattagc
cctgataaactgaatcatatcagaaaagaacgtttaaaatcactcgggcttaatgataaa
gcgatttatgcaaatatcaacagaatcaaagaggaactcgagtatttcgaaaagattgtg
gatcggatcggctgccaggttgttgatgtttcaaataaagcggttgaggaaacagcaaat
attatccatcatctcaaaacaaaaaacatataa

DBGET integrated database retrieval system