KEGG   Bacillus subtilis subsp. subtilis 168: BSU25250
Entry
BSU25250          CDS       T00010                                 

Symbol
ccpN
Name
(RefSeq) transcriptional repressor CcpN
  KO
K23774  DeoR family transcriptional regulator, catabolite repression regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU25250 (ccpN)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   DeoR family
    BSU25250 (ccpN)
SSDB
Motif
Pfam: CBS HTH_11 HTH_DeoR MarR HTH_24 HTH_Mga HTH_PafC GntR TFIIE_alpha HrcA_DNA-bdg HTH_AsnC-type HTH_20
Other DBs
NCBI-GeneID: 937886
NCBI-ProteinID: NP_390403
Pasteur: BG13768
BSORF: BG13768
UniProt: O34994 A0A6M4JNP9
Structure
Position
complement(2604959..2605597)
AA seq 212 aa
MSTIELNKRQEHILQIVKENGPITGEHIAEKLNLTRATLRPDLAILTMSGFLEARPRVGY
FYTGKTGTQLLADKLKKLQVKDFQSIPVVIHENVSVYDAICTMFLEDVGTLFVVDRDAVL
VGVLSRKDLLRASIGQQELTSVPVHIIMTRMPNITVCRREDYVMDIAKHLIEKQIDALPV
IKDTDKGFEVIGRVTKTNMTKILVSLSENEIL
NT seq 639 nt   +upstreamnt  +downstreamnt
gtgagtacgatcgaactaaataaacggcaagaacatattttgcagattgtaaaagaaaac
gggccgattacaggggagcatattgcagaaaagctgaacctaaccagggcgacattgcgc
ccggatttagccatactcaccatgtcaggattcctcgaggcgcgcccgagagtcggttat
ttctatacgggaaaaaccggcacacagcttttggcggataaactcaaaaagcttcaggtg
aaagactttcaatctatccccgtagtgattcacgaaaacgtttctgtgtacgatgcgatt
tgcaccatgtttttagaagatgtaggtactctgtttgtggtggaccgcgatgctgtttta
gtcggggtgctttcacgaaaagacttgctcagagcgagcattggccagcaggagcttaca
tcggtccctgttcacatcatcatgacaaggatgccgaacattacggtgtgcagacgcgag
gattatgtgatggacattgcaaagcacttaatagaaaaacaaattgatgcactgcctgtc
atcaaagacaccgataaaggctttgaagtgatcggcagagtgacaaaaacaaatatgacc
aaaatacttgtcagtttatctgaaaatgaaatcctataa

DBGET integrated database retrieval system