KEGG   Bacillus subtilis subsp. subtilis 168: BSU25300
Entry
BSU25300          CDS       T00010                                 

Symbol
cdd
Name
(RefSeq) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU25300 (cdd)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     BSU25300 (cdd)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2
Other DBs
NCBI-GeneID: 937885
NCBI-ProteinID: NP_390408
Pasteur: BG10477
BSORF: BG10477
UniProt: P19079 A0A6M4JLI6
Structure
Position
complement(2610927..2611337)
AA seq 136 aa
MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAERTALF
KAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVVLTNLQGQIKEMTVEEL
LPGAFSSEDLHDERKL
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaacagacaagaattaataacagaagctttaaaagcgcgtgatatggcatatgcgccg
tattccaaattccaagtaggagccgctcttcttaccaaggatggaaaagtgtacagaggc
tgcaatattgagaacgcggcatacagcatgtgcaattgcgccgagcgtaccgctttattt
aaagctgtttctgaaggggatacagagtttcagatgctggccgttgcggctgacacccct
ggaccagtatctccgtgcggagcctgccgacaggtgatttctgagctttgcacaaaagac
gttattgtcgtactgactaatttacaaggacaaataaaagaaatgactgtggaagaatta
ttgccaggcgcattttcatcggaggatttacatgacgaacgaaagctttaa

DBGET integrated database retrieval system