KEGG   Bacillus subtilis subsp. subtilis 168: BSU25310
Entry
BSU25310          CDS       T00010                                 

Symbol
dgkA
Name
(RefSeq) undecaprenol kinase
  KO
K00887  undecaprenol kinase [EC:2.7.1.66]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU25310 (dgkA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.66  undecaprenol kinase
     BSU25310 (dgkA)
SSDB
Motif
Pfam: DAGK_prokar TgpA_N
Other DBs
NCBI-GeneID: 937873
NCBI-ProteinID: NP_390409
Pasteur: BG11040
BSORF: BG11040
UniProt: P19638 A0A6M4JKV7
Position
complement(2611456..2611827)
AA seq 123 aa
MDSKDHRNELNRFFKSFVHAGRGIWETARTERNFQFHAAAACAVLICGFLVELSIIEWMI
IFLLIGGMFSLELLNTAIEHTVDLITDKHHPLAKAAKDAAAGAVCVFAVISCIIGLLIFL
PKL
NT seq 372 nt   +upstreamnt  +downstreamnt
atggactcaaaagatcatagaaatgagctgaatcgattcttcaaaagcttcgtgcatgca
ggccggggcatatgggaaacagcgcggacggagcggaatttccaatttcatgccgcagcc
gcctgcgctgttctcatttgcggcttccttgtagagctcagcattattgagtggatgatt
atattccttttgataggtggtatgttttcgcttgaacttttaaatacagccattgaacat
acggttgatttaataactgacaaacatcaccctcttgctaaagcggccaaggacgctgcc
gccggggctgtttgcgtttttgccgtgatttcgtgtatcattggtttacttatttttttg
ccaaagctgtaa

DBGET integrated database retrieval system