KEGG   Bacillus subtilis subsp. subtilis 168: BSU25320
Entry
BSU25320          CDS       T00010                                 

Symbol
yqfG
Name
(RefSeq) metalloprotease
  KO
K07042  probable rRNA maturation factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25320 (yqfG)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  Other maturation factors
   BSU25320 (yqfG)
SSDB
Motif
Pfam: YbeY Peptidase_M10
Other DBs
NCBI-GeneID: 937869
NCBI-ProteinID: NP_390410
Pasteur: BG11656
BSORF: BG11656
UniProt: P46347 A0A6M3ZE10
Position
complement(2611808..2612281)
AA seq 157 aa
MSLLIDIVDETGSVSEEMLKEVENLLQFAAEREGVQDQAEVSVTIVSNDDIHQINKEYRG
KDAPTDVISFALEEEGEGEIEIVGAEMPPVLGDIIISADRTREQAEEYNHSFKRELGFLA
VHGFLHLLGYDHMTKEEEEEMFTKQKELLDAYGLKRS
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttactgattgatatcgttgatgaaacgggaagcgtctcagaagagatgctcaaa
gaagtagaaaatctgcttcaatttgccgctgagcgtgaaggcgttcaggatcaggctgaa
gtttctgtcacgattgtttccaatgatgacatacatcagattaacaaagaataccgggga
aaggatgctccgacagatgtcatctcatttgctcttgaagaagagggagaaggcgagatc
gaaatcgtgggcgccgaaatgcctccggttttaggtgatattatcatcagtgccgatcgc
acaagagagcaggcagaggagtataatcattcttttaaaagagagctcggatttctagct
gtacacggatttctgcaccttttaggatatgaccatatgacgaaagaggaagaagaggag
atgtttactaagcaaaaggaattgctggacgcttatggactcaaaagatcatag

DBGET integrated database retrieval system