KEGG   Bacillus subtilis subsp. subtilis 168: BSU25330
Entry
BSU25330          CDS       T00010                                 

Gene name
yqfF
Definition
(RefSeq) hypothetical protein
  KO
K07037  cyclic-di-AMP phosphodiesterase PgpH [EC:3.1.4.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU25330 (yqfF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     BSU25330 (yqfF)
SSDB
Motif
Pfam: 7TM-7TMR_HD 7TMR-HDED HD HDOD HD_6
Other DBs
NCBI-GeneID: 937877
NCBI-ProteinID: NP_390411
Pasteur: BG11655
BSORF: BG11655
UniProt: P46344
Position
complement(2612282..2614417)
AA seq 711 aa
MLKKKAKTKSSSKKWSSFKNARSMHVLLYLLLAAIMFALLFVHVKPETLDLDLFSVSDKT
IYAPATVEDQKATEEKKQAAEDAVEDQYTLKKEYTDNRIDLVSSIFDSISEVKKSSEEGS
KSPSEKSMVKSVKDKLTSDVNDSISEDSIKTLLKADSEDFSFVRDTVITAVNTVMSSEIP
SDKLSDAKDKVEKELKSNSIPSKYLGAATEIGRFAIIPNYVFDPKATEAKRQEASDNVQQ
VQIKQGQVLVEENDLIDREVYRKLELTGLLNNSNLFKPISGLLIMIGLFIATLVYYFEKQ
KQNLKFKNQSILLFSIITTLLLVIMEVVSLFQKMEYNNIGYLVPIAAGAILIKLLMNERI
AILGSIILAICGSMMFNQGVTGTFNYVIGIYYLISGISGVLFLGKHNARSKILQTGLFVA
FINMVVVLSLLLIQNTALSGLEIGTLMLMGVVSGFASSVLIIGLMPFFETGFGILSTMRL
LELSNPNHPLLRKILTETPGTYHHSVMVANLSEAACEAVGANGLLARVGAYYHDLGKTKR
PQYFIENQMNIDNPHDKLSPQLSKNIIISHTTDGANMLRSYKFPKELVDIAEQHHGTSLL
KFFYYKAKEKGDQITEEEFRYPGPKPQSKEAAIISVADSVEAAVRSMHNPNPERIEKLVR
GIISDKLQDGQFSECDLTFKELDTIAKTLCATLKGIFHSRIEYPEATKKVK
NT seq 2136 nt   +upstreamnt  +downstreamnt
gtgttgaaaaagaaggctaagaccaaaagcagctcaaaaaaatggagcagttttaaaaat
gcccgctccatgcatgtactgctgtatcttctgctggctgccattatgtttgctttgctc
tttgtacatgttaagccggaaacacttgatttagacctgttttcagtcagcgacaagacc
atttacgctccggcaaccgtagaagatcaaaaagccacagaggaaaaaaagcaagccgct
gaggacgcggttgaagatcaatatacattaaaaaaagaatatacagacaatcggattgac
cttgtgtcatcaatattcgacagtattagtgaagtgaaaaaatcatcggaagaaggcagt
aaatcaccatcggaaaaatcaatggtcaaatctgtaaaggacaaattgacatcagatgtg
aatgattctatatcggaggattccatcaagacattgctgaaagcagacagtgaagacttt
tcttttgtcagagatacggtcattaccgcggtaaatacggtcatgagcagtgaaatccct
tcggataaactatctgatgcaaaggataaggtagaaaaagagctaaagagcaattctatt
ccgtctaaatacttgggagccgcgacagaaatcgggcgttttgctattattccgaattac
gtcttcgatccgaaagcaacagaggcaaaacggcaggaagcctcagataatgtccagcag
gttcaaatcaaacaggggcaagtgctcgtggaagaaaatgacctcattgatcgggaagtg
tacaggaaacttgagctgaccgggttattaaataactcaaatctctttaaaccgatcagc
gggctattgattatgatcggacttttcattgcaacacttgtatattattttgaaaaacag
aaacaaaatctgaagtttaaaaaccaatccattctgttattctccataatcacaacactt
ttgcttgtgatcatggaggttgtcagtttgtttcagaagatggagtataataatatcggc
tatctggtccccattgcggccggcgccatcttaatcaaactgctgatgaatgaacgcatt
gccattttgggaagtatcattcttgcgatttgcggaagtatgatgtttaatcagggtgtg
acaggaacattcaattatgtcatagggatttattatttgatcagcggcatttcaggtgta
ttatttttaggaaaacacaatgcaagatcaaagattttgcagaccggacttttcgtggcg
tttattaatatggttgtcgttctatccttattattgatccagaacactgcgctgtcgggt
cttgaaatcggcacgttaatgctcatgggggttgtgtcggggtttgcttcatctgtattg
atcatcggtctgatgccgttttttgagacgggctttggcattttatccaccatgaggctg
ctcgagctgtctaatcctaaccatccgctattgcgcaaaatactgacggaaacaccaggt
acatatcatcacagtgtaatggttgccaatttatcagaggcagcctgtgaagcggttggg
gctaatggtttgcttgcaagagtcggcgcatattatcacgatctcggaaaaacaaagcgc
ccgcaatattttattgaaaaccaaatgaatattgacaatccgcatgacaagctgtcacct
cagttgagcaaaaatattattatctcgcatacgacagacggtgcgaatatgctgagaagc
tataaatttccgaaagagcttgtcgatattgctgagcagcatcatggaacctcgctttta
aagtttttttactataaagcgaaggaaaaaggcgaccagattacagaggaagagttccgt
tatccgggaccgaagccgcagtcaaaggaagccgcaattatatcagtggccgacagtgtt
gaagcggccgtcagatccatgcacaatccaaatcctgaacgaattgaaaagcttgtccgg
ggtattatatccgataagcttcaggacggacagttcagtgaatgcgatttgacatttaaa
gagctggatacaatcgcaaaaacgctctgtgcaacattaaaaggaattttccactcccgg
attgaatatccggaggctactaagaaggtgaaatag

DBGET integrated database retrieval system