KEGG   Bacillus subtilis subsp. subtilis 168: BSU25350
Entry
BSU25350          CDS       T00010                                 

Symbol
yqfD
Name
(RefSeq) hypothetical protein
  KO
K06438  similar to stage IV sporulation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU25350 (yqfD)
SSDB
Motif
Pfam: YqfD
Other DBs
NCBI-GeneID: 937867
NCBI-ProteinID: NP_390413
Pasteur: BG11654
BSORF: BG11654
UniProt: P54469 A0A6M3ZJ55
Position
complement(2615452..2616648)
AA seq 398 aa
MKNKWLSFFSGKVQLELTGRGIERLLNECTRQGIPVFHVKKKKEAVSLYIQLQDVHAFRR
VRSKFKCKARFINRKGFPFLLLKSKLNIGFTIGFAIFFILLFLLSNMVWKIDVTGAKPET
EHQMRQHLNEIGVKKGRLQFLMMSPEKIQKSLTNGIDNITWVGVDLKGTTIHMKVVEKNE
PEKEKYVSPRNIVAKKKATITRMFVQKGQPMAAIHDHVEKGQLLVSGLIGSEDHQQEVAS
KAEIYGETWYRSEVTVPLETLFNVYTGKVRTKHKLSFGSLAIPIWGMTFKKEELKHPKTE
QEKHSLHFLGFKLPVSYVKEQTRESEEALRKYTKEEAVQEGIKLGKQDVEDKIGENGEVK
SEKVLHQTVENGKVKLIILYQVIEDIVQTTPIVRETEE
NT seq 1197 nt   +upstreamnt  +downstreamnt
gtgaaaaataaatggctgtcttttttttcgggtaaggtccagcttgaattgacgggaaga
gggattgagcggctccttaatgaatgcacaagacaggggattccggtctttcatgtcaaa
aaaaagaaagaagccgtatcgttatatatacagcttcaggatgtacatgcctttcggcgg
gtaagaagtaaatttaaatgtaaagcccgatttatcaatcggaagggatttcccttcctg
ttgctgaaatcaaagctgaatatagggtttacgatcggttttgcgatttttttcattctt
ttgtttttgctgtccaatatggtgtggaaaattgatgtgacaggcgctaagcctgaaaca
gaacatcaaatgaggcagcatcttaatgaaatcggcgtcaaaaagggccgtctgcagttt
ttaatgatgtcgcccgaaaaaatacagaaatcattaaccaatggaatagacaatatcact
tgggtcggagttgatctgaaggggacgaccattcatatgaaagttgtggagaaaaatgag
cccgaaaaagaaaaatatgttagcccgcgcaatattgtcgccaaaaagaaagcaaccatt
acgagaatgtttgtgcaaaaaggacagcccatggccgccatacacgatcatgttgaaaag
ggacagctgcttgtttcgggactgatcggcagcgaagaccatcagcaggaagtcgcctca
aaagcagaaatttatggagaaacctggtatagatcagaagtgacagtcccgcttgaaaca
ttatttaacgtctatacgggcaaagtaaggacaaagcacaagctttcttttggttctttg
gcaatcccgatctgggggatgacgtttaaaaaagaggaattgaagcatccaaaaacagaa
caagaaaagcattcgcttcattttctcggatttaagctccctgtatcctatgtcaaagag
caaacgagagaaagtgaagaggctttgcgaaaatatacaaaagaagaagcagttcaagaa
ggcattaaattgggtaaacaggatgtagaggataaaataggcgaaaacggcgaggtgaaa
agtgaaaaagttttgcaccagactgttgagaatggtaaagtaaagttgattattctctac
caagttatagaagatatcgttcaaaccacacctattgtcagggagactgaagaatga

DBGET integrated database retrieval system