KEGG   Bacillus subtilis subsp. subtilis 168: BSU25360
Entry
BSU25360          CDS       T00010                                 

Symbol
yqfC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YabP
Other DBs
NCBI-GeneID: 937870
NCBI-ProteinID: NP_390414
Pasteur: BG11653
BSORF: BG11653
UniProt: P54468 A0A6M3ZEK8
Position
complement(2616667..2616948)
AA seq 93 aa
MGQRKNRMKAWLTRALEIPPDVMMDLPRITMVGRLHIYIENHRGLLLFSENEVRLMLKQG
QCIISGKNFVIKAILPEEILLEGTIDVVRYVES
NT seq 282 nt   +upstreamnt  +downstreamnt
atggggcaaagaaagaatcgtatgaaagcttggctgacaagagcattggaaattcccccg
gacgttatgatggatctgccgaggattacaatggttggcagacttcatatctacatagaa
aaccacagaggccttttgcttttcagtgagaatgaagtgcggctgatgctgaagcagggc
cagtgcatcatatctggtaaaaattttgtcatcaaggcgattcttccggaagagatactt
ttggagggtacgattgatgtcgttcgatatgttgagtcataa

DBGET integrated database retrieval system