KEGG   Bacillus subtilis subsp. subtilis 168: BSU25370
Entry
BSU25370          CDS       T00010                                 

Symbol
yqfB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RNase_Y_N DUF4834 TP53IP5 OATP FUT8_N_cat Ndc1_Nup Presenilin O-antigen_lig
Other DBs
NCBI-GeneID: 937864
NCBI-ProteinID: NP_390415
Pasteur: BG11652
BSORF: BG11652
UniProt: P54467 A0A6M3ZDY3
Position
complement(2617005..2617424)
AA seq 139 aa
MEDLLTNPLIIAAIIGIISAIFGKKSKEEKQNSQKRKKPQHVQSASPQKKQSKEDAPAPI
PNRMEQARREAEERRRETARNLKGLERDLAAAKQKTVYTKQKMLQVNKDTVVQGIVLGEV
FGPPRAKKPHRTMRPARKN
NT seq 420 nt   +upstreamnt  +downstreamnt
atggaagatttactgaccaatccgcttattattgcagcgatcatcggaatcatttctgcg
attttcggcaaaaagagcaaagaagaaaagcaaaacagccaaaaaagaaaaaaacctcaa
cacgtgcaatctgcttctcctcaaaagaagcagtcaaaagaagatgcccctgcacctatc
cctaaccgtatggaacaggcaagacgggaagcggaagaaagacgcagggaaacagcaaga
aacctgaaagggctggaacgagatcttgctgctgccaaacaaaaaacagtatacacaaaa
caaaaaatgcttcaggtgaataaagacaccgtcgtacaggggatcgttctaggagaggtg
ttcggacctccacgggcgaaaaaacctcaccgtacgatgcgcccggcccgtaaaaattaa

DBGET integrated database retrieval system