KEGG   Bacillus subtilis subsp. subtilis 168: BSU25390
Entry
BSU25390          CDS       T00010                                 

Symbol
yqeZ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NfeD SDH_sah Peptidase_S49 CLP_protease Peptidase_S41 DUF6057 ECH_1
Other DBs
NCBI-GeneID: 937859
NCBI-ProteinID: NP_390417
Pasteur: BG11650
BSORF: BG11650
UniProt: P54465 A0A6M3ZED7
Position
complement(2618466..2619779)
AA seq 437 aa
MLQIKGFRAALLGIFLLSLLGVQLNAKAEKQTVYVIPVEKNVEQGLASFLSRSLQDAKDA
HADHIILDINTPGGLVKSAIDMADLITESEIPVTAYVNKRALSAGAYIALQADHIYMAPG
GKMGAAAIVDGQGNAADQKAQSLWLAEMEDAAVKNNRDPKYALAMADPDIDAKEVGAPKG
DLLTLNADKAIEVGYSEGTADNLSTLVKKLGFEKAQISYAKESFAEKTARWLTNPVIVPI
LLTIAFLGLTVELFSPGVGLPGTAGLIALLLFFYGHLAAGLAGYETVLLFIAGVILILLE
IFLPGGIIGLLGLGAIIASLFLAAGSFTVMAVSLLIASAVSITAFILLTRVLGKRMKFFK
KLILNDSTNTESGYVSNQTRTDLMGKVGITFTPLRPSGTVIIDDERLDVVSEGSFTEKDK
KVKVIKVEGSRIVVREI
NT seq 1314 nt   +upstreamnt  +downstreamnt
ttgcttcaaatcaaaggattccgtgctgctcttttgggtatatttttactttctttatta
ggcgtacagctgaacgcaaaagcagaaaaacaaactgtttatgtgatcccggttgaaaaa
aatgtcgaacagggtctcgcctcgtttttgtcccgttcgttacaagacgcaaaggatgca
catgcagaccatattattcttgatatcaataccccggggggattggtcaaatctgctatt
gatatggccgatttgataaccgaaagcgagatccccgtaactgcatatgtcaacaaacgc
gcgttgtctgctggtgcatatattgcacttcaagcagatcacatttatatggcgcctggc
ggaaaaatgggagccgccgcgattgttgatggccaaggcaatgccgctgaccaaaaagct
caatcactttggctggcagagatggaagatgccgcagtgaaaaataaccgcgatccaaaa
tatgcgctcgcaatggctgacccagatatagatgccaaggaagttggcgcgcctaaggga
gatctgctgacacttaacgcagacaaggcgattgaggtaggctattcagaaggcactgct
gacaatttgtccacgctcgtaaagaagcttgggttcgaaaaggcgcagatcagctatgca
aaggagagctttgcggaaaagacggcaagatggctgacgaatccggtcattgtccctatt
ctgctgacaatcgcttttttaggtctgacggtagagcttttttccccgggtgtcggcctc
cctggaacggctggactcattgcgttattgctgttcttttacgggcatcttgcagccggc
cttgccgggtatgagacggttctcctctttatagcaggggtgattctcattctgcttgag
atttttcttcccggaggaatcattggattactgggcttgggagcgattattgcgagcctg
tttttagccgcggggagcttcactgtcatggcggtttctctcttgatcgcctcagctgtt
tcgattacagcttttattttactgacaagggtgttgggaaagcgtatgaaattctttaag
aaattgatattaaatgattctacaaacacggagagcggctacgtttcaaatcaaacgcgc
acggacttaatgggaaaagtgggtataacctttacaccgctgcgtccttccggtaccgtg
attattgatgatgaacgccttgacgttgtatcggagggatcgtttacagaaaaagataaa
aaagtaaaagtgataaaagtagaaggctcacgcattgtcgtgagagaaatttaa

DBGET integrated database retrieval system