KEGG   Bacillus subtilis subsp. subtilis 168: BSU25400
Entry
BSU25400          CDS       T00010                                 

Symbol
yqeY
Name
(RefSeq) hypothetical protein
  KO
K09117  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU25400 (yqeY)
SSDB
Motif
Pfam: YqeY GatB_Yqey Ribosomal_S8e DUF4953
Other DBs
NCBI-GeneID: 937860
NCBI-ProteinID: NP_390418
Pasteur: BG11649
BSORF: BG11649
UniProt: P54464 A0A6M4JLJ6
Structure
Position
complement(2619910..2620356)
AA seq 148 aa
MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQ
RKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMG
KVMGAIMPKVKGKADGSLINKLVSSQLS
NT seq 447 nt   +upstreamnt  +downstreamnt
atgagtcttcttgagcgtctcaaccaggatatgaagctgtatatgaaaaaccgtgagaaa
gacaaactgactgtcgttcgaatggttaaggcttcacttcaaaatgaagcaattaagctt
aagaaagacagtttgaccgaggatgaggaactcactgtcctttctcgtgaacttaagcaa
cgtaaagactccctccaggaattttcaaacgctaatcgtttagatttagtagataaagtt
caaaaagagctggacattttagaagtttatttacctgagcagctgtcagaagaagagctg
cgtacaatcgtaaatgaaaccatcgcggaggtcggtgcgagctcaaaagcggacatgggc
aaagtgatgggggcaattatgcctaaagtaaaaggtaaagctgacggaagtttaattaat
aagcttgtgagcagtcaactgtcttaa

DBGET integrated database retrieval system