KEGG   Bacillus subtilis subsp. subtilis 168: BSU25410Help
Entry
BSU25410          CDS       T00010                                 

Gene name
rpsU
Definition
(RefSeq) 30S ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU25410 (rpsU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU25410 (rpsU)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU25410 (rpsU)
  Bacteria
    BSU25410 (rpsU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21 CBS
Motif
Other DBs
NCBI-GeneID: 937861
NCBI-ProteinID: NP_390419
Pasteur: BG11648
BSORF: BG11648
UniProt: P21478
Position
complement(2620371..2620544)
Genome map
AA seq 57 aa AA seqDB search
MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKRKF
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacggtcgttagaaaaaacgaatcgcttgaagatgctcttcgtcgcttcaaa
cgcagtgtatcaaagacaggtactttgcaagaagcaagaaagcgtgaattttatgaaaaa
cctagcgtaaagcgcaagaaaaagtctgaagctgctagaaaacgcaaattctaa

DBGET integrated database retrieval system