KEGG   Bacillus subtilis subsp. subtilis 168: BSU25420
Entry
BSU25420          CDS       T00010                                 

Symbol
yqeW
Name
(RefSeq) hypothetical protein
  KO
K03324  phosphate:Na+ symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU25420 (yqeW)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU25420 (yqeW)
SSDB
Motif
Pfam: Na_Pi_cotrans DUF2231 Arv1
Other DBs
NCBI-GeneID: 937858
NCBI-ProteinID: NP_390420
Pasteur: BG11647
BSORF: BG11647
UniProt: P54463 A0A6M3ZE21
Position
2620717..2621640
AA seq 307 aa
MLILISFTALILFFLAGMNMLRKGLISMAYSKIEERLLLFTDHPLKAFLISIVFTGILQS
SSAFMVIVIGFVSAGVLSFKRTIPMILGTNVGSTFTTEFIAIKMDIVIWVLLIGGLLFFL
TGRYPLKQLGTSFLGLGIIFFCISGFSHLAGPLTKLKTGADVLYHVNDSNWSALLIGMVL
TAIIHSSSVCIGILMSFMNEGIIGLTQAMSVVLGSNIGTCITAVMAAVSGGYAAKQTAYA
HVVFNVLGVALVLPFLTAATGFVEQLSPDPAQKIAHFSLLFNVVTALLFLPLTNLFYRLI
HLLIPAK
NT seq 924 nt   +upstreamnt  +downstreamnt
atgttaattctgattagctttactgctcttatattattctttctcgcaggcatgaacatg
cttcgaaagggcttaatttcaatggcgtactcaaaaattgaagaacgtttgcttttattt
acagaccatccgttaaaagcgtttcttatcagtattgtatttacggggatacttcagagc
agctcagcctttatggtcattgtcatcggctttgtaagtgcgggcgttctttcttttaag
cggacgatcccgatgattctggggacaaatgttggctctacttttacaactgaatttatt
gctatcaaaatggatattgtgatttgggttcttttaataggaggtttattgttttttctg
actggcaggtatcctttgaaacagctgggaacaagcttccttggactgggcatcatcttc
ttttgcatcagcggattcagccatcttgccgggccgctgacaaagctgaaaacgggcgcc
gacgttctataccatgttaacgattcaaactggtccgctttgctcatcggcatggtgtta
actgccatcattcactccagttctgtctgtatcggcattttgatgagttttatgaatgaa
gggattatcggactgacacaggcgatgagcgtcgtactcggatcaaatatcgggacatgc
attacagctgtcatggctgctgtatccggcggatatgcggcgaaacagacagcatatgcc
catgtggtatttaacgtgctaggggtggctctagtattgccttttctgaccgcagcgacc
ggctttgtagagcagttatcacctgatcccgcacaaaagatcgcgcatttcagcctttta
tttaatgtggtgacagctcttttatttcttccgcttacaaacttgttttaccgattgatt
caccttcttatcccggctaaataa

DBGET integrated database retrieval system