KEGG   Bacillus subtilis subsp. subtilis 168: BSU25430
Entry
BSU25430          CDS       T00010                                 

Symbol
rimO
Name
(RefSeq) threonylcarbamoyladenosine tRNA methylthiotransferase MtaB
  KO
K18707  threonylcarbamoyladenosine tRNA methylthiotransferase MtaB [EC:2.8.4.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU25430 (rimO)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.5  tRNA (N6-L-threonylcarbamoyladenosine37-C2)-methylthiotransferase
     BSU25430 (rimO)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Methylthiotransferases
    BSU25430 (rimO)
SSDB
Motif
Pfam: Radical_SAM UPF0004 TRAM B12-binding
Other DBs
NCBI-GeneID: 937857
NCBI-ProteinID: NP_390421
Pasteur: BG11646
BSORF: BG11646
UniProt: P54462 A0A6M4JJK9
Position
complement(2621677..2623032)
AA seq 451 aa
MATVAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVINTCTVTNTGDKKSRQV
IRRAIRQNPDGVICVTGCYAQTSPAEIMAIPGVDIVVGTQDREKMLGYIDQYREERQPIN
GVSNIMKARVYEELDVPAFTDRTRASLKIQEGCNNFCTFCIIPWARGLLRSRDPEEVIKQ
AQQLVDAGYKEIVLTGIHTGGYGEDMKDYNFAKLLSELDTRVEGVKRIRISSIEASQITD
EVIEVLDRSDKIVNHLHIPIQSGSNTVLKRMRRKYTMEFFADRLNKLKKALPGLAVTSDV
IVGFPGETEEEFMETYNFIKEHKFSELHVFPYSKRTGTPAARMEDQVDENVKNERVHRLI
ALSDQLAKEYASQYENEVLEIIPEEAFKETEEENMFVGYTDNYMKVVFKGTEDMIGKIVK
VKILKAGYPYNEGQFVRVVEDEITEHMRLSS
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcaactgttgctttccatacgcttggctgtaaagtcaaccattatgaaacagaagca
atctggcagcttttcaaagaagcgggctatgaaagaagagactttgaacaaacagctgat
gtatatgtcattaatacatgtacggttacaaatacgggagataaaaaaagccgccaagtg
atcagacgcgccattcgtcaaaatcctgacggtgtcatctgtgtcacaggctgctacgcg
caaacctcacctgctgagattatggcgatccccggtgtcgacattgtagtcggaacacag
gaccgtgaaaaaatgcttggctacattgaccaataccgagaagaacgccagccgattaat
ggcgtcagcaacatcatgaaagcaagagtatatgaagagcttgatgtgcctgctttcacg
gaccgcacaagagcgtcattgaaaatacaggagggctgcaataatttctgcacattctgt
atcattccgtgggcgagaggcctgctccgctcccgcgaccctgaagaagtcattaaacaa
gcgcagcagcttgtcgatgccggatataaggaaattgttcttacgggtattcatacaggc
ggctacggcgaagatatgaaagattacaacttcgcgaagcttttgagcgaattagacacc
cgtgtggaaggcgtgaaacggatcagaatttcttcaatcgaagccagccaaatcactgac
gaagtgatcgaggtcttagaccgctcagataagatagtgaatcatttgcatattcctatc
caatccggatcaaacacagtgcttaaacggatgagacgcaaatatacaatggaattcttt
gcagaccgtttaaataaattgaaaaaagcactgccaggcttagctgttacttctgatgtc
atcgtcgggttccctggagaaacagaagaagaatttatggaaacctataactttattaaa
gaacataaattctctgagctgcatgttttcccttacagtaagcgtacaggaacaccagct
gcacgaatggaagaccaagtggatgaaaacgtgaaaaacgaacgtgtgcaccgcctgatt
gctctttctgaccagcttgcaaaagaatacgcttctcagtatgaaaatgaagtgcttgag
attatccctgaggaagcgtttaaggaaacagaagaagaaaatatgtttgtcggttacaca
gacaattatatgaaggttgttttcaaaggtacggaagatatgatcggcaaaatcgtaaaa
gtcaaaatcctaaaagcaggttatccttacaacgaaggacagtttgtccgtgtggttgag
gatgaaataactgaacacatgcgtttgtcttcttaa

DBGET integrated database retrieval system