KEGG   Bacillus subtilis subsp. subtilis 168: BSU25440
Entry
BSU25440          CDS       T00010                                 

Symbol
yqeU
Name
(RefSeq) ribosomal RNA small subunit methyltransferase E
  KO
K09761  16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25440 (yqeU)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     BSU25440 (yqeU)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BSU25440 (yqeU)
SSDB
Motif
Pfam: Methyltrans_RNA PUA_4
Other DBs
NCBI-GeneID: 937856
NCBI-ProteinID: NP_390422
Pasteur: BG11645
BSORF: BG11645
UniProt: P54461 A0A6M4JNQ3
Structure
Position
complement(2623032..2623802)
AA seq 256 aa
MQRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSK
DKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKL
DDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYEESSKQ
GEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDGVTCGLGPRILRTETAPLY
ALSAISYQTELLRGDQ
NT seq 771 nt   +upstreamnt  +downstreamnt
atgcaacgatattttatcgagctcacgaagcagcaaatagaggaagcgccgactttttcg
attaccggcgaagaagttcatcatattgtgaacgtgatgagaatgaatgagggagatcag
attatctgctgctctcaagacggcttcgaggcaaaatgtgaacttcaatctgtttccaaa
gataaagtgtcctgccttgtgatagaatggacgaatgaaaacagagagcttccgataaag
gtctatattgcgagcggccttccgaaaggagataagcttgaatggattatccaaaagggg
actgagctcggagctcatgcctttattcctttccaagccgcgcgttctgttgtcaagctg
gatgacaaaaaggcaaagaaaaagcgggaaagatggacgaaaattgcgaaggaagcggct
gagcaatcgtaccgtaacgaagtgccgcgagtgatggatgtccattcttttcagcagctt
cttcaaaggatgcaggatttcgataaatgtgtcgttgcatacgaggagtcatcgaagcaa
ggggaaataagcgcattcagcgcgattgtaagcagccttccgaaaggatcatctctattg
atcgtatttggtcccgaaggcggtttaacagaagcggaggttgaacggctcacagagcaa
gacggtgtgacgtgcggccttggaccgagaattttaaggacagaaaccgctccgctatac
gcgttgagtgcgatttcttatcaaacagagttattaagaggtgatcagtaa

DBGET integrated database retrieval system