KEGG   Bacillus subtilis subsp. subtilis 168: BSU25450
Entry
BSU25450          CDS       T00010                                 

Gene name
prmA
Definition
(RefSeq) ribosomal protein L11 methyltransferase
  KO
K02687  ribosomal protein L11 methyltransferase [EC:2.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25450 (prmA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BSU25450 (prmA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  ribosomal protein modification factors
   BSU25450 (prmA)
SSDB
Motif
Pfam: PrmA MTS Met_10 Methyltransf_18 Methyltransf_23 Methyltransf_31 Methyltransf_25 Methyltransf_12 TRM CMAS PCMT NNMT_PNMT_TEMT Methyltransf_11 Cons_hypoth95 UPF0020 GCD14 Methyltransf_16 GidB DUF4816 Methyltransf_32
Other DBs
NCBI-GeneID: 937847
NCBI-ProteinID: NP_390423
Pasteur: BG11644
BSORF: BG11644
UniProt: P54460
Position
complement(2623825..2624760)
AA seq 311 aa
MKWSELSIHTTHEAVEPISNILHEAGASGVVIEDPLDLIKERENVYGEIYQLDPNDYPDE
GVIVKAYLPVNSFLGETVDGIKETINNLLLYNIDLGRNHITISEVNEEEWATAWKKYYHP
VKISEKFTIVPTWEEYTPVHTDELIIEMDPGMAFGTGTHPTTVLCIQALERFVQKGDKVI
DVGTGSGILSIAAAMLEAESVHAYDLDPVAVESARLNLKLNKVSDIAQVKQNNLLDGIEG
EHDVIVANILAEVILRFTSQAYSLLKEGGHFITSGIIGHKKQEVKEALEQAGFTIVEILS
MEDWVSIIAKK
NT seq 936 nt   +upstreamnt  +downstreamnt
ttgaaatggtccgaattaagcattcacacaacacatgaagcggtcgaacctatctcaaat
atattgcatgaagctggtgcaagtggggttgtgatagaggacccgcttgatttaattaaa
gaacgtgagaatgtgtacggggaaatctaccagctcgaccccaatgattacccagatgag
ggtgtcattgtcaaagcatatctgccggttaacagttttctgggcgaaactgtagacggc
atcaaagaaacgattaataatctccttctttacaatattgatttgggcagaaaccacatc
actatttctgaagtaaatgaagaagagtgggcgactgcctggaaaaagtattatcatcct
gtgaaaatttctgaaaagtttacaattgtgccgacgtgggaggaatatacgccggtccat
actgatgaactgattattgaaatggacccgggaatggctttcggcacagggacacatccg
acaaccgtactctgcattcaggcgcttgaacgctttgtgcaaaagggtgataaggtgatt
gatgtcggcactggttcgggaattttaagtattgcggctgcaatgcttgaggctgaatcg
gttcatgcctacgatcttgatcccgtggctgtagaaagtgcacgcctcaatctcaagctg
aacaaagtcagcgatattgctcaagtgaagcaaaacaatttgttagacgggattgaaggg
gaacatgatgtgattgtggccaacattttggctgaagtcattcttcgctttacttcacaa
gcgtacagcctgttaaaagaaggcggtcactttattacgtcaggaatcatcggtcataaa
aaacaagaagtaaaagaagcactggaacaagctggctttaccattgtagaaatcctttca
atggaagattgggtcagcattattgcgaaaaaataa

DBGET integrated database retrieval system