KEGG   Bacillus subtilis subsp. subtilis 168: BSU25480
Entry
BSU25480          CDS       T00010                                 

Symbol
grpE
Name
(RefSeq) heat shock protein GrpE
  KO
K03687  molecular chaperone GrpE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU25480 (grpE)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU25480 (grpE)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP24
   BSU25480 (grpE)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    BSU25480 (grpE)
SSDB
Motif
Pfam: GrpE Fis1_TPR_C
Other DBs
NCBI-GeneID: 937846
NCBI-ProteinID: NP_390426
Pasteur: BG10663
BSORF: BG10663
UniProt: P15874 A0A6M4JL48
Structure
Position
complement(2627971..2628534)
AA seq 187 aa
MSEEKQTVEQNETEEQEIIEEQAAADEQQEETNESELLQNQINELQGLLEEKENKLLRVQ
ADFENYKRRSRLEMEASQKYRSQNIVTDLLPALDSFERALQVEADNEQTKSLLQGMEMVH
RQLVEALKKEGVEAIEAVGQEFDPNLHQAVMQAEDENYGSNIVVEEMQKGYKLKDRVIRP
SMVKVNQ
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtcagaagaaaaacaaaccgttgaacaaaacgaaacagaagagcaagaaatcattgaa
gaacaagctgccgctgatgaacagcaggaagaaacaaatgaaagcgaacttcttcaaaac
caaattaacgaattgcaaggtttgcttgaggaaaaagaaaacaaacttttgcgtgttcaa
gcagactttgaaaactataaacgacgcagccgtttagagatggaagcgtcccaaaaatac
cgttctcaaaatatcgtgactgatttgctgccggctcttgacagttttgaacgagcgctt
caggttgaagccgacaatgaacagacgaaaagtttgctccagggaatggaaatggtccac
cgtcagctcgtagaagccttgaaaaaagaaggcgtcgaagccatcgaagctgtagggcag
gaatttgatcctaatctgcaccaagctgttatgcaggctgaagacgaaaactacggctcc
aacattgttgttgaggaaatgcaaaaaggctataagctgaaggatcgcgtcattcgccct
tccatggtcaaagtgaatcaataa

DBGET integrated database retrieval system