KEGG   Bacillus subtilis subsp. subtilis 168: BSU25490
Entry
BSU25490          CDS       T00010                                 

Symbol
hrcA
Name
(RefSeq) heat-inducible transcription repressor HrcA
  KO
K03705  heat-inducible transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU25490 (hrcA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU25490 (hrcA)
SSDB
Motif
Pfam: HrcA HrcA_DNA-bdg HTH_11 HTH_12 HTH_DeoR Med2 LexA_DNA_bind Ribosomal_S19e
Other DBs
NCBI-GeneID: 937843
NCBI-ProteinID: NP_390427
Pasteur: BG10662
BSORF: BG10662
UniProt: P25499 A0A6M4JLY1
Position
complement(2628606..2629637)
AA seq 343 aa
MLTNRQLLILQVIINDFIKSAQPVGSRTLSKKDEITFSSATIRNEMADLEELGFIEKTHS
SSGRVPSEKGYRYYVDHLLSPVKLTKSDLDQIHSIFKEKIFELEKTVQKSAQILSDLTNY
TSIVLGPKLSENYLKQIQIIPIQPDMAVAILVTNTGHVENKTINFPTKMDLSDIEKLVNI
LNDRLSGVPMDELNERIFKEVVMYLRQHIKNYDNILDALRSTFHSTNHVEKLFFGGKINM
LNQPEFHDITRVRSLLSLIEKEQDVLKLVQSPHTGISIKIGKENDYEEMENCSLITASYS
VDQKQIGSIAIIGPTRMNYSRVVSLLQHVTSDLSKALTSLYDE
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgttaacaaatcgtcagctgctgatccttcaggttataatcaacgattttattaaatcg
gcacagccggtgggatcaagaactctttcgaaaaaagatgaaatcacatttagctctgca
acaataagaaacgagatggctgacttggaggaattgggctttattgaaaaaacccattca
tcctcaggacgtgttccgtcagaaaaagggtatcggtactatgttgaccatttgctgtca
cccgtcaaattgacgaaaagcgacctggaccaaatccactcgatcttcaaagagaaaatt
ttcgagctggagaagacagttcaaaaatcagcgcaaattttgtccgatctgacgaattac
acatccatcgtactcgggccgaagttgagtgagaattaccttaaacagattcaaatcatt
ccgattcagcctgatatggcggtagcgattctcgttaccaatacggggcatgtggaaaac
aaaacgattaactttccgaccaaaatggatctgtctgatattgaaaaactggtaaatata
ctgaacgaccgtttaagcggcgttccaatggatgaactgaatgagcgcatatttaaagaa
gttgtcatgtacctaagacagcacattaaaaactatgacaatatactcgacgcgcttcgt
tcaacctttcattccacaaatcacgttgaaaagttgttttttggcgggaaaatcaatatg
ctgaaccagcctgagttccatgatatcacccgagttcggtcgctgctttcattaattgag
aaagaacaggatgttttaaagctggttcaatccccgcacacgggaatttcgattaaaatc
ggaaaagaaaacgactatgaagagatggaaaattgcagtctgattacggcttcttattcc
gtagaccagaagcagatcggctcaattgcgattatcggcccgacccgcatgaattattcc
agggttgtcagcctgcttcagcatgtgacttcggacttgtcaaaagcattaacaagtctg
tatgatgaataa

DBGET integrated database retrieval system