KEGG   Bacillus subtilis subsp. subtilis 168: BSU25500
Entry
BSU25500          CDS       T00010                                 
Symbol
hemN
Name
(RefSeq) oxygen-independent coproporphyrinogen-III oxidase 1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Radical_SAM HemN_C Fer4_12 Fer4_14 DUF6429 HTH_45
Other DBs
NCBI-GeneID: 937845
NCBI-ProteinID: NP_390428
Pasteur: BG11395
UniProt: P54304 A0A6M3ZEE2
Position
complement(2629718..2630857)
AA seq 379 aa
MKSAYIHIPFCEHICHYCDFNKYFIQSQPVDEYLNALEQEMINTIAKTGQPDLKTIFIGG
GTPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVEANPDDLSAEKLKILKEAGVNRLSFGV
QTFEDDLLEKIGRVHKQKDVFTSFERAREIGFENISLDLMFGLPGQTLKHLEHSINTALS
LDAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEIVMSKMEAHGIHQYEISNF
AKAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPVKHYIDLIAEKGFPYRDTHE
VTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPSVLKDLAEKGLIHNSESAVYL
THQGKLLGNEVFGAFLGEL
NT seq 1140 nt   +upstreamnt  +downstreamnt
ttgaaatcagcttatatccatatcccattttgtgagcatatttgccactactgcgatttc
aataaatattttattcaaagtcagccagtcgacgagtatttaaacgcactcgaacaggaa
atgataaatacaatagcaaaaaccgggcagcctgatctcaaaacaatctttatcggagga
ggcacgccgacctccctgtctgaggaacagcttaaaaagctgatggatatgatcaaccgc
gtgctaaagccctcaagcgacttatcggaatttgcggttgaagcgaatccggacgatttg
tccgcagagaaattaaaaatattaaaagaagcaggcgtaaatcgccttagctttggtgtg
caaacgttcgaagacgatctgttagaaaaaatcggccgagtgcacaagcaaaaagatgta
ttcacctcttttgaaagagcgcgggaaatcggttttgagaatatcagtcttgatctcatg
ttcgggcttccggggcaaaccctcaagcatctggaacattccataaacactgctttatca
ttggacgctgagcattattccgtttactcccttattgtagaaccgaaaacggtattttat
aatttgatgcaaaaagggcggcttcatcttccgccgcaggagcaggaagctgaaatgtat
gaaatagtgatgagcaagatggaagctcacggcattcatcaatatgaaatcagcaacttt
gctaaggcaggcatggaatctaagcacaatctaacgtattggagcaacgaacaatatttc
ggtttcggagctggcgctcacggatatattggcggcacacgaacagtgaacgtcggacct
gttaagcattacattgacctgatagctgaaaagggttttccgtacagagatacacatgaa
gtgacaacagaagaacagattgaggaagaaatgtttttaggtttgagaaaaacagccggt
gtcagcaaaaaacgattcgcagaaaaatacggccgttccctggatggacttttcccaagc
gtgttaaaagacctcgctgaaaaagggctgattcacaattcggagtctgccgtttatttg
actcatcaagggaaattattaggcaatgaagtttttggcgcttttttgggtgagttataa

DBGET integrated database retrieval system