KEGG   Bacillus subtilis subsp. subtilis 168: BSU25500
Entry
BSU25500          CDS       T00010                                 

Gene name
hemN
Definition
(RefSeq) oxygen-independent coproporphyrinogen-III oxidase 1
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU25500 (hemN)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BSU25500 (hemN)
SSDB
Motif
Pfam: Radical_SAM HemN_C Fer4_12 Fer4_14 DUF6429 HTH_45
Other DBs
NCBI-GeneID: 937845
NCBI-ProteinID: NP_390428
Pasteur: BG11395
BSORF: BG11395
UniProt: P54304 A0A6M3ZEE2
Position
complement(2629718..2630857)
AA seq 379 aa
MKSAYIHIPFCEHICHYCDFNKYFIQSQPVDEYLNALEQEMINTIAKTGQPDLKTIFIGG
GTPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVEANPDDLSAEKLKILKEAGVNRLSFGV
QTFEDDLLEKIGRVHKQKDVFTSFERAREIGFENISLDLMFGLPGQTLKHLEHSINTALS
LDAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEIVMSKMEAHGIHQYEISNF
AKAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPVKHYIDLIAEKGFPYRDTHE
VTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPSVLKDLAEKGLIHNSESAVYL
THQGKLLGNEVFGAFLGEL
NT seq 1140 nt   +upstreamnt  +downstreamnt
ttgaaatcagcttatatccatatcccattttgtgagcatatttgccactactgcgatttc
aataaatattttattcaaagtcagccagtcgacgagtatttaaacgcactcgaacaggaa
atgataaatacaatagcaaaaaccgggcagcctgatctcaaaacaatctttatcggagga
ggcacgccgacctccctgtctgaggaacagcttaaaaagctgatggatatgatcaaccgc
gtgctaaagccctcaagcgacttatcggaatttgcggttgaagcgaatccggacgatttg
tccgcagagaaattaaaaatattaaaagaagcaggcgtaaatcgccttagctttggtgtg
caaacgttcgaagacgatctgttagaaaaaatcggccgagtgcacaagcaaaaagatgta
ttcacctcttttgaaagagcgcgggaaatcggttttgagaatatcagtcttgatctcatg
ttcgggcttccggggcaaaccctcaagcatctggaacattccataaacactgctttatca
ttggacgctgagcattattccgtttactcccttattgtagaaccgaaaacggtattttat
aatttgatgcaaaaagggcggcttcatcttccgccgcaggagcaggaagctgaaatgtat
gaaatagtgatgagcaagatggaagctcacggcattcatcaatatgaaatcagcaacttt
gctaaggcaggcatggaatctaagcacaatctaacgtattggagcaacgaacaatatttc
ggtttcggagctggcgctcacggatatattggcggcacacgaacagtgaacgtcggacct
gttaagcattacattgacctgatagctgaaaagggttttccgtacagagatacacatgaa
gtgacaacagaagaacagattgaggaagaaatgtttttaggtttgagaaaaacagccggt
gtcagcaaaaaacgattcgcagaaaaatacggccgttccctggatggacttttcccaagc
gtgttaaaagacctcgctgaaaaagggctgattcacaattcggagtctgccgtttatttg
actcatcaagggaaattattaggcaatgaagtttttggcgcttttttgggtgagttataa

DBGET integrated database retrieval system