KEGG   Bacillus subtilis subsp. subtilis 168: BSU25510
Entry
BSU25510          CDS       T00010                                 

Symbol
lepA
Name
(RefSeq) elongation factor 4
  KO
K03596  GTP-binding protein LepA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GTP_EFTU LepA_C EFG_C GTP_EFTU_D2 EFG_III MMR_HSR1 Ras RF3_C SRPRB PduV-EutP MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 937840
NCBI-ProteinID: NP_390429
Pasteur: BG10441
BSORF: BG10441
UniProt: P37949 A0A6M4JKY0
Position
complement(2630910..2632748)
AA seq 612 aa
MTDKEKRLERQSRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERER
GITIKLNSVQLKYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEA
QTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIE
EILEQIVEKVPAPTGDPEAPLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGK
EFEVTEVGVFTPKATPTNELTVGDVGFLTASIKNVGDTRVGDTITSAANPAEEALPGYRK
LNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEI
IQERIEREFNIDLITTAPSVIYDVYMTDGEKVVVDNPSNMPDPQKIERVEEPYVKATMMV
PNDYVGAVMELCQGKRGNFIDMQYLDANRVSIIYDMPLAEIVYEFFDQLKSSTKGYASFD
YELIGYKPSKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQ
AAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFM
AVLKMDDSPKKQ
NT seq 1839 nt   +upstreamnt  +downstreamnt
gtgacagataaagaaaagcgtttagagaggcaatcgagaatacggaatttctctatcatt
gcccatattgaccacggaaaatcgaccttagcggatcgtattttagaaaaaacgtcggca
atcactcaacgagaaatgaaagaacaattgctcgattctatggatcttgaacgtgagcgg
ggcataaccattaaattaaactctgttcagcttaaatataaagcaaaagacggagaagaa
tatatctttcatctaatcgatacgccgggacacgtcgacttcacgtatgaagtatcccga
agccttgctgcctgcgagggagcgattcttgtcgtggatgcagcccaggggattgaagcg
cagacgctcgccaatgtctacttagcgcttgacaacgatcttgaaatccttccggtcatc
aataaaatcgaccttccgagcgccgagcccgaacgtgtgcgccaagaggtagaagacgtt
atcggccttgacgcatcagaagccgtgcttgcttcagcaaaagccggtatcgggattgag
gagattttagaacaaatcgtagaaaaggtgccagctccgaccggagatccggaggcgccg
ctcaaagcgctgatcttcgactcgctttatgacgcctaccgcggtgtcgtggcttatatc
agagtcgttgaaggaacggtaaagccgggacaaaaaatcaaaatgatggcaaccggcaaa
gaattcgaagtaacagaggtgggcgtgttcacgccgaaagcaactccgacaaatgaactg
acggtcggtgatgtaggcttcctgactgcctcaatcaaaaatgttggtgacacacgtgtc
ggtgatacaataacgagcgctgccaatcctgcagaagaagcgctgccgggataccgcaag
ctaaacccgatggtgtactgtggtttgtatccgattgatacagcgaagtataatgattta
agggaagctcttgaaaagcttgagctgaatgattcctcccttcaatatgaagcggaaact
tcgcaagcgcttggattcgggttccgctgcggatttttaggcatgcttcacatggagatc
attcaggagcgaattgagcgtgagttcaacatcgacctgattacgacagcgccaagcgtt
atctatgacgtgtatatgacagacggcgaaaaggtcgttgtcgacaacccgtccaacatg
ccggatcctcaaaagatcgaaagggttgaggagccatacgtaaaagcgacgatgatggtg
ccgaatgactatgtcggcgctgtaatggagctttgccaaggaaaacgcggcaatttcatt
gatatgcagtatttagacgcaaaccgtgtcagcatcatttatgatatgccattagcggaa
atcgtatatgagttttttgatcagctgaaatcaagcactaaaggctatgcgtcctttgat
tatgaactgatcggctacaaaccgtccaagcttgtgaaaatggacattatgctgaatggt
gaaaaaatcgatgccctttcctttatcgtgcatcgtgattacgcatatgaacggggaaaa
gtgatcgttgaaaaactgaaagaactcattccgcgccagcagtttgaagttccggtacaa
gccgcaatcggccagaaaatcgtggcccgctccaccataaaagcaatgcgtaaaaacgta
ttggctaaatgttacggaggggacatctcgcgtaaacggaaacttcttgaaaaacaaaaa
gaaggaaagcgccgtatgaagcaggtcggctcagttgaagtgccgcaagaagcatttatg
gcagttctgaaaatggacgacagtccgaaaaaacaatag

DBGET integrated database retrieval system