KEGG   Bacillus subtilis subsp. subtilis 168: BSU25520Help
Entry
BSU25520          CDS       T00010                                 

Gene name
yqxA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3679 Orn_DAP_Arg_deC DUF3188
Motif
Other DBs
NCBI-GeneID: 937841
NCBI-ProteinID: NP_390430
Pasteur: BG10440
BSORF: BG10440
UniProt: P38425
Position
complement(2632882..2633220)
Genome map
AA seq 112 aa AA seqDB search
MIAYFGKCLLLVTIMFLGVLFGMQQANHGMLSMKGYHDPSLKGAFTLTDGKDNEKEASIL
GETVTAKDLVEKQKELEKVETFNMFSKAGKALSDTVTNTAQSMYEWIRDMNQ
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
ttgattgcatactttggaaagtgcttactgcttgtcacgatcatgtttttaggcgttctg
ttcggcatgcagcaggcaaaccacgggatgctgagtatgaaaggctatcatgacccttca
ctgaagggggcgtttacgctcaccgacggaaaagataatgaaaaagaagcctcaatccta
ggagaaacagtcacggcaaaagatttagtagaaaaacaaaaagagctggaaaaggtggag
acattcaatatgttttcaaaagccggaaaagcgctttcggacaccgtaaccaatactgcc
cagtcaatgtatgaatggatacgggatatgaatcaataa

DBGET integrated database retrieval system