KEGG   Bacillus subtilis subsp. subtilis 168: BSU25520
Entry
BSU25520          CDS       T00010                                 

Symbol
yqxA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3679 Orn_DAP_Arg_deC DUF3188
Other DBs
NCBI-GeneID: 937841
NCBI-ProteinID: NP_390430
Pasteur: BG10440
BSORF: BG10440
UniProt: P38425 A0A6M4JMH2
Position
complement(2632882..2633220)
AA seq 112 aa
MIAYFGKCLLLVTIMFLGVLFGMQQANHGMLSMKGYHDPSLKGAFTLTDGKDNEKEASIL
GETVTAKDLVEKQKELEKVETFNMFSKAGKALSDTVTNTAQSMYEWIRDMNQ
NT seq 339 nt   +upstreamnt  +downstreamnt
ttgattgcatactttggaaagtgcttactgcttgtcacgatcatgtttttaggcgttctg
ttcggcatgcagcaggcaaaccacgggatgctgagtatgaaaggctatcatgacccttca
ctgaagggggcgtttacgctcaccgacggaaaagataatgaaaaagaagcctcaatccta
ggagaaacagtcacggcaaaagatttagtagaaaaacaaaaagagctggaaaaggtggag
acattcaatatgttttcaaaagccggaaaagcgctttcggacaccgtaaccaatactgcc
cagtcaatgtatgaatggatacgggatatgaatcaataa

DBGET integrated database retrieval system