KEGG   Bacillus subtilis subsp. subtilis 168: BSU25530
Entry
BSU25530          CDS       T00010                                 

Symbol
spoIIP
Name
(RefSeq) stage II sporulation protein P
  KO
K06385  stage II sporulation protein P
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU25530 (spoIIP)
SSDB
Motif
Pfam: SpoIIP
Other DBs
NCBI-GeneID: 937842
NCBI-ProteinID: NP_390431
Pasteur: BG10439
BSORF: BG10439
UniProt: P37968 A0A6M3ZE30
Position
complement(2633237..2634442)
AA seq 401 aa
MRNKRRNRQIVVAVNGGKAVKAIFLFIVSLIVIFVLSGVLTSLRPELRPSSDSFYGIAEE
LPGDVFAHLLQMENHYFASDLSQTDSSFHLSRLSLKLATSINLEDPRSFLGRELPGFAQF
DTEILLAGQGTDYTNMPAESPPPSKVMEEEREANLAEIEKQQTQSDNAQKDPPKQTTGDK
KVVFIYHTHNTESYLPLLKGETDPDMARHSKANVTLVGDMFGQALESQGIGATVNKTDIQ
SKLNKKGLNYARSYDESRPVVKDALASNKNLQYIIDIHRDSRRKKDTTATIKGKSYARVA
FVVGKKSKNFEENYKIASELHKLMEKKYPGLSTGVFSKGSPGDNGVYNQDLTDRALLLEF
GGVDNNLEELQRAANAAADVFSEMYWDAEKVNAASGETKKQ
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgagaaataaacgcagaaacagacagattgttgttgcggtaaatggagggaaagcggta
aaagccatctttctatttatcgtaagccttatcgtgatttttgttctatccggtgtgctg
acgtctctccggccggaacttaggccgtcgtctgactctttttatgggattgctgaagaa
ttgccgggtgacgtatttgcacatttgctgcagatggaaaaccattatttcgcttctgac
ctctctcaaacagacagctcatttcatctttctcgtctttctttaaagctggcgacgagc
attaacctcgaagatccgcggagctttctcggtcgggagctgccaggatttgcacaattt
gataccgagattttgttagctggacaaggaacggattatacgaatatgcctgcggaatcg
ccgccgccgtctaaggtgatggaggaagaaagagaagcgaatttggcagagattgaaaaa
cagcaaacgcaatcagataatgcgcaaaaagatccgccgaaacaaacaacaggtgataaa
aaggtcgtgtttatctatcacacgcacaatacggaatcatatctccctctattaaaaggc
gagaccgatcctgacatggcgcgccattctaaagccaatgtcacgcttgtaggagatatg
ttcggacaagcgcttgaatcccagggaatcggagccacagtgaataaaaccgatatacag
tcaaaattgaataaaaaaggcttaaactatgccaggtcctatgatgaatcaaggccggtc
gtgaaagacgccctcgcttcaaacaaaaatctgcaatatatcattgacatccacagagac
tctcggcgcaaaaaagacacaaccgcaacgattaaagggaaaagctatgccagggtagcc
tttgtcgtcgggaaaaaaagcaaaaacttcgaagaaaactataaaattgcgagtgagctt
cataaactgatggagaaaaaataccccggacttagcacaggtgtcttttccaaaggctcg
ccaggcgataatggtgtttacaatcaggatttaaccgatagagcgcttttgctcgagttt
ggcggagtggataataatctcgaagagctgcagcgtgcggctaacgcggccgcggacgta
ttcagcgaaatgtactgggatgctgaaaaggtcaacgcagcgagcggggagacgaaaaaa
caataa

DBGET integrated database retrieval system